Story cover for Bad Blood by RedValya
Bad Blood
RedValya
  • WpView
    MGA BUMASA 555
  • WpVote
    Mga Boto 8
  • WpPart
    Mga Parte 8
  • WpHistory
    Oras 38m
  • WpView
    MGA BUMASA 555
  • WpVote
    Mga Boto 8
  • WpPart
    Mga Parte 8
  • WpHistory
    Oras 38m
RedValya
Kumpleto, Unang na-publish May 17, 2020
bestfriendsdeceptionfamilyfanficfriendshipkinkincontestlifelessonsshortstorysingaporewritingchallengewritingcontest
When two ambitious, generous boys get wind of a controversial deal between their powerful families, they must learn to play the rules of a shameless world and choose between family obligations and a long-lasting friendship.
#kin #kincontest
Public Domain
bestfriendsdeceptionfamilyfanficfriendshipkinkincontestlifelessonsshortstorysingaporewritingchallengewritingcontest
Table of contents

8 parte

Sign up to add Bad Blood to your library and receive updates
o
#339kin
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
More than a Friend. ni ArsieClaire
17 parte Ongoing
PS: This is not Omega verse... Short story... Slow update...
My Bodyguard Love [Completed] ni laydeeshannon
20 parte Kumpleto
Inspired by @primkayecaete, I couldn't help but want to draft this story on Kinn & Big. It's definitely completely ghostship and major crackpairing af, but my fujoshi heart wants. And what it wants, it will get. But I do hope everyone will learn to enjoy and love this story too!
Will you still love me? ni liasvp
16 mga parte Kumpleto Mature
VegasPete fanfic. What if Vegas was found cheating on Pete?? What if Pete totally give up on their love and started moving on?? Will Vegas be able to ever win Pete over again??? Read the story to find out. This is just a thought that is being lingering in my mind for the past few days. Just thought of putting it into words. Kinn and Vegas are very good friends. I removed the two oldies from this fanfic as I don't like them. CONCEPTS: MPREG BDSM FOUL LANGUAGE LOVE TRIANGLE VIOLENCE SELF HARM SUICIDAL THOUGHTS U PPL r already warned... Hv a good reading. #1 biblebuild #2 vegaspete #1 kinnporsche #1 kinn
MARRIAGE ni KinnlovePorche
19 mga parte Kumpleto Mature
kinn's family and porsche's family are friends since childhood. they want to make their friendship stay forever.so they decide to make their sons marry to each other. I also don't know how to this story going Completed.
CAREFUL ni polkadotsss_
14 mga parte Kumpleto
"I'm definitely going to rip his head off!"
Falling for the Forbidden ni laydeeshannon
28 parte Kumpleto
Kinn, the ruthless heir to a powerful mafia empire, has never had time for love-until he crosses paths with Chay, the innocent and kind-hearted younger brother of his most trusted bodyguard, Porsche. At first, Kinn only notices Chay because of his naive admiration for Kim, Kinn's younger brother. But when Kinn uncovers the painful truth-that Kim had only drawn Chay in as a pawn for the family's hidden schemes-something inside him shifts. Guilt, protectiveness, and an unfamiliar warmth begin to cloud Kinn's judgment. He never intended to interfere, yet he finds himself drawn to Chay's light, to the softness that his own world of blood and betrayal has long buried. Despite knowing that Chay should stay far away from the dangers of his life, Kinn can't stop himself from getting closer. For Chay, Kinn is everything he should fear-a man who lives by violence and power, a man whose world has only ever brought him pain. But as Kinn shows him unexpected gentleness, as he shields him from the very darkness he was born into, Chay starts to see beyond the ruthless leader to the man beneath. Their love is a dangerous gamble-one that could shatter loyalties, test Porsche's limits, and ignite a war within the family. But some hearts refuse to be caged, even in the depths of the underworld. Will Kinn defy his fate to protect Chay, or will their love be swallowed by the darkness that surrounds them?
Throneful friendship ni aminnu
111 parte Ongoing Mature
«Not everything in life goes as we plan» This is a story of two friends who met unexpectedly and they end up being friends despite their differences ,but this doesn't stop their friendship except by grieve misunderstanding which leads them to separation. "Why would you do this?" "Same thing you did to my brother Sara?" "Why would you play me like this? "Why would you deny that you are in love with Alex?" "Are you for real Simran? I would never betray you , you know that am in love with Yasar Follow them in their journey in the midst pains, heartbreaks, lies, betrayals,hurts deceives...
I'll Be There For You ~ SiMi SS[COMPLETED]✓ ni serialfreek_14
7 parte Kumpleto
Monu bro ke paas SidG hamesha tha, hain aur......... Kya wo hamesha rahega? A ZDMN FS(5 chapter book) BASED ON THE FRIENDSHIP OF SID AND MONAMI Monu and Sid have been trained commando's since a year and now it's time to come in action..... >A mission to accomplish, > a friendship to hold, > a country to protect, > a person to care, > a moment to share, > a life to Live and > a death to Die for the country.... What is a friendship when your life is at stake! Life as you know it holds its twists and turns but can this friendship emerge being ever stronger? NOTE *I don't hold any rights to the characters of the story, but the story is entirely my imagination* Started On : 4th January 2022 Completed on : 5th February 2022 Copyright © reserved 2021 serialfreek_14
This is not our Goodbye ni rcbrie15
13 parte Kumpleto Mature
Friendship that has been tested by time. Will they stick to the blanket of friendship just to be safe? Or face their obvious reality that whats between them is far more than deep than their mind could fathom.... A/N Join me again to the journey of Forth and Beam towards life and love! Credits to the rightful owners of all the characters and pictures of this story. #Chiffon_cake #2moons #forthbeam #taetee
The Merger ni meloshaz
25 parte Kumpleto
Enemies into lovers. What follows? Is it ever smooth sailing? Will it last? How long until lovers become enemies? This time, will either survive? Two stubborn hardworking headbutting CEO'S thrown together by circumstances finding a mutually beneficial way to survive, a merger. Feelings become entwined and it brings about a merger of the heart. Is this their happily ever after? Personal ties and relationships come to the fore presenting new challenges. Our calculating business partners and newly formed life partners must navigate a way to survive once again, but can they. When familial ties, trust and loyalty is put to the test will they sacrifice each other or sacrifice for each other? 🌹 (Please Note: These characters, their story and their lives are completely fictional. Thank you for reading. Please leave a comment and a 👍🧡 if you do. Your comments and opinions are much appreciated. ) 🫶
Magugustuhan mo rin ang
Slide 1 of 10
More than a Friend. cover
My Bodyguard Love [Completed] cover
Will you still love me? cover
MARRIAGE cover
CAREFUL cover
Falling for the Forbidden cover
Throneful friendship cover
I'll Be There For You ~ SiMi SS[COMPLETED]✓ cover
This is not our Goodbye cover
The Merger cover

More than a Friend.

17 parte Ongoing

PS: This is not Omega verse... Short story... Slow update...

Karagdagang detalye