Solar Eclipse
bunniesace
  • Reads 20,751
  • Votes 1,187
  • Parts 4
  • Time 21m
  • Reads 20,751
  • Votes 1,187
  • Parts 4
  • Time 21m
bunniesace
Ongoing, First published May 20, 2020
bloodfounderofdiabolisimgoregrandmasterofdemoniccultivationmdzsmodaozushitimetravelvampirevampireweiyingwangxianweiwuxianweiyingwenwenweiying
When Wei Ying destroys the Stygian Tiger Seal he expected his corpses to turn on him as the boundless resentful energy from the seal ran rampant in his body. However it didn't, instead he watched as the resentful energy swirled around his body until he couldn't see nor move.
Was he dying?

'Are you willing?' A voice echoed within Wei Ying's head.

'Willing to what?' Wei Ying thought confused.

'To pay the price to go back and change everything.' The voice echoed and Wei Ying felt a chill go down his spine.

'Whatever the price, I am willing to pay.' Wei Ying thought with unwavering conviction.

Several different giggles echoed around him,
 'then, we shall lend you a hand in your endeavours.'

_________


This is a mix of au's, time travel, Wen! Wei Ying and vampire Wei Ying.
All Rights Reserved
bloodfounderofdiabolisimgoregrandmasterofdemoniccultivationmdzsmodaozushitimetravelvampirevampireweiyingwangxianweiwuxianweiyingwenwenweiying
Table of contents

4 parts

Sign up to add Solar Eclipse to your library and receive updates
or
#2wen
Content Guidelines
You may also like
Not The Wei Ying Of The Past by HarukiUsagi46
12 parts Complete
When Wei Ying removed his hand from Lan Zhan hand, he look up at Lan Zhan, he can see the hurt, the sadness and how devastated Lan Zhan is when he see the person he love the most is falling down to the abyss below him. While falling down toward the abyss below him one thing went through his mind, 'Lan Zhan, if I could have one wish....I wish that I got the chance to tell you that I love you. If there is a chance for me to change the past then I will change everything. I'm sorry my Hanguang Jun.' Will Wei Ying be who he is in the future or will he change himself? Let's find out shall we. This is another Wei Wuxian dominated over Lan Wangji.
Reverse Time by HarukiUsagi46
22 parts Complete
When Wei Ying let go of Lan Zhan hand, Lan Zhan know that he doesn't want to live in a world where there is no Wei Ying , the person who he consider his soulmate. So he decide to jump after Wei Ying. "Wei Ying!" Wei Ying opened his eye, he see Lan Zhan falling toward him. "Lan Zhan?" Lan Zhan stretched out his hand for Wei Ying to take, "Wei Ying Take my hand! Please Wei Ying!" "Why?! Don't you hate me?!" Shouted back Wei Ying. "No! No! No! Your Wrong! I Don't hate you! Please take my hand! I'm begging you, Wei Ying!" Wei Ying can see how desperate Lan Zhan want to save him so he stretched out his hand for Lan Zhan to take. Closer closer closer closer until two red light and two blue light come together and then..... -_^ let's read it in the story okay.
THE PRINCE'S MATES by AshLhie20
78 parts Ongoing
Bai Ying is the Heaven Realm Crown Prince who also crowned with the title of 'balance' under his name. He is the only son of the family of Bai and the most pampered and loved. He is also sweet, loving and caring but sometimes, there's seems to have a switch that everything turned south. Bai Wang finally called for him not to do their own bonding which is playing board games but to give an edict that Ying will and must complete alone. Bai Ying who is clueless almost fell on his butt when he finally heard that he must find his mate as soon as possible. Not because Wang is getting old, but because of the fact that Ying is not getting any younger anymore. The poor Ying agreed as to this is the first time his father ordered him but not at the same time. He immediately left the Heaven Realm but to be welcomed with a surprise. His mate is not only a 'mate' but actually... 'mates'! How will Bai Ying be able to handle the group of his unexpected mates? How will he ba able to deal with the incoming issues and obstacles they are about to face? Will he be able to finish the mission and come back home? Or to return with more things placed on his shoulder aside from his mates alone? ----- Date Started to Write: 28th of July 2023 Date Published: 30th of July 2023 ----- Language: English Genre: Romance, Action, Historical Fiction, BL Tags: #maleharem #vampireking #alphaking #elf #merman #archangel #rivalry
The Ultimate and the Immortals by Arami_arami
18 parts Complete Mature
From his blurry vision, he could guess who his savior was. No one was strong and fast enough to save him from any predicament except HIM. "Why are you back?" "I heard your cry for help." When Zhang Qiling tried to pull Wu Xie up from the steep cliff, another round of snow slope slid down at a frightening speed ready to swallow them whole--an avalanche. "Xiao ge, watch out!!!" Then, everything turned black. !!!WARNING!!! THERE WILL BE MATURE CONTENTS SUCH AS TORTURE, GRAPHIC DEPICTIONS OF VIOLENCE, DRUG, POISON, BLOOD, GORE ON CHAPTER 14 and 15!!!
PETRONIUS(BXB){ COMPLETED} by AnnaBaibe
13 parts Complete Mature
"A fucking Vampire as my mate" Zhan whispered as he walked down the peer as the rays of the beautiful Sunset of Untamed City drew near. " I don't see a problem. Am handsome, wealthy and powerful." Wangs Voice carried itself to Zhan's ears. The intensity of his sexy voice, with a deep baritone sound was enough to cause shivers down his Zhan's spine. His Wolf whimpered and his cock became Harder. This is not what he had anticipated. " How bored can you be that you keep following me" Zhan sounding sarcastic , trying to hide how affected he was. " Bored enough to know that I can affect you. You wolf wants to come to me. Should I summon it ? _____________________________________________ Two Paranormal Kings. Vampires and Werewolf were sworn enemies. Now that the mating bond has been activated. What will happen to Untamed City?
Complications (MxM) by StxnedWriter
16 parts Complete Mature
**WARNING** ~contains explicit content that may not be acceptable to all viewers. discretion advised~ "No no no no..." My words trailed "NO!!" I screamed, pulling harshly at all my restraints, attempting to get free, hearing the harsh clank of metal on metal with every movement. Colder than the table beneath me, chills ran through my body. This couldn't be happening, please. A sadistic laugh rang through the room and my head fell in defeat as my eyes squinted closed, not wanting to see his face. "Yes, actually." I felt his disgusting, filthy hands trail down my arms. I could feel him leaning forwards, moving himself closer to me. I couldn't bring myself to open my eyes, so I just lay there, waiting for what I knew was to come. "You're mine now, mut." His voice made my body tense more than it already had. The way he sounded so angry. So possessive. I dared myself to speak, "W-what ar-are you gonna d-do to me?" My voice shook and wavered so much in my fear that it was numb to my ears. Alpha Dave let out a low, calloused chuckle that sent chills throughout my body. He said, in a deadly low voice, "I'm going to remind you who you belong to." * DISCLAIMER- In this story world, each person gets five potential mates! * Blake Daniels' story has been one tragedy after another, Complications littering his route, tripping him on his journey through life. At this point, he's entirely disgusted by his Complacency. For as long as he can remember, he has been at the whim of everyone's desires, neglecting his own. This left him wondering: what it is he wants? Could it be the sweet relief of death? Escape? Or simple Convalescence? *** ~Ms.Witch *** BOOK ONE IN THE ~Escape~ SERIES! Book 1: ~Complications~ Original Created- 2015, Completed- 2016 Rewrite Created (October) & Completed (December)- 2023 Book 2: ~Complacency~ Created (January) & Completed (March)- 2024 Book 3: ~Convalescence~ Created (April) & Completed (May)- 2024 Thanks for reading!
MDZS: The Mount's angel by YeoGermaine
17 parts Ongoing
At just three years old, Wei Ying secretly follows his parents on a dangerous mission near the cursed Burial Mounds. When tragedy strikes and his parents are critically wounded, his desperate cries awaken the undead. But instead of attacking, the zombies reveal remnants of their humanity, guiding Wei Ying the Burial Mounds' Secret Ying to save his family. Now, living among the dead, Wei Ying must navigate a fragile life in the treacherous Burial Mounds while uncovering the truth about the undead's torment and his own extraordinary destiny. A tale of courage, compassion, and the blurred line between life and death.
Wei Wuxian: The Primordial Abyss by Jillianmrls
6 parts Ongoing Mature
The Yiling Patriarch - Wei Wuxian's life ended during the First Siege of Burial Mounds. He is whispered in fear, his legends twisted in terror. But the gods saw everything. --- For the first time in eons, a mortal ascended into godhood beyond life and death, becoming both deity and domain. Wei Wuxian, with his golden-heart and boundless resilience, is crowned as the Primordial God of Underworld and Tartarus. His soul resonated with raw power of these realms. He rules as a being of unfathomable beauty and overwhelming might-a form form cloaked in shadow, with sharp, symmetrical features that could shame the most exquisite jade carvings. His crimson eyes glow. The wrath of Tartarus and the endless sorrow of the Underworld. His hair, long and black as the abyss, flows like a cascade of liquid night, while his smile-equal parts alluring and cruel-strikes terror into the hearts of even the gods. As Tartarus, Wei Wuxian commands chaos itself, imprisoning wicked deities, unruly spirits. As Underworld, he governs the balance of life and death, guiding lost souls, passing judgment. His carries a weight that bends reality; a single word can ignite storms or calm the roaring sea of the dead. --- Wei Wuxian stayed in his realm, thinking the world hates him. But unknown to him, he made a truth array in case anything went wrong, but forgot about it after. It was during the First Siege that people have disturb it with some other experimental talismans and the truths are revealed too late. ... 13 years later, Wei Wuxian is summoned in the living world from what he thought. He is worshipped as hero and deity. ❤️ Primordial God! Wei Wuxian AU ❤️
Back From The Dead With Secret by HarukiUsagi46
21 parts Complete
When Wei Ying let go of Lan Zhan hand, he waited for the impact of the ground with hIs body. Wei Ying didn't feel the impact instead he hear, "Wei Wuxian. This isn't the right way for you to die." "Who are you?" Wei Ying asked with his conscience. "My name is Hua Cheng. I saw what happen to you. I will show you whose behind what happen at Qiongqi path and at NeverNight." What Wei Ying about to see will make him want to destroy the whole Jin clan. Also, Wei Ying will also take his anger out on Lan Qiren......he saw something that make him very very very very dangerous angry. Let's see what will Hua Cheng show Wei Ying.
only "cultivation partners" | 🐇XICHENG🌸 by LOS3RZXX
25 parts Complete
in which a story where meng yao and his sworn brothers try to find cultivation partners. but for xichen and jiang cheng, their dating life only forms while being partners and facing challenges. follow jiang cheng and lan xichen to their story with a series of difficult challenges. jiang cheng is YunmengJiang sect's sect leader. comments would be appreciated- THE DEATHS NEVER HAPPENED EXCEPT YANLI'S AND ZIXUAN'S. THE FALL OF THE WEN CLAN HAPPENS DIFFERENTLY IN THE STORY. MENG YAO AND XUE YANG ISNT CRAZY- WEN NING IS STILL A CORPSE AND WEN QING IS ALIVE HELPING. YILING PATRIARCH IS PRAISED AND RESPECTED. best rankings so far: #1 in lanxichenxjiangcheng TYSMM❤️❤️❤️ #1 in mingyao PLSS ISTG I LOVE Y'ALL- 4-8-22 #2 lanzhanxweiying 7-11-22 #2 mdzsfanfic 7-11-22 #3 xueyang 7-11-22 #8 in xiaoxingchen SHIPS: 🌸xicheng🌸 main ship 🤍wangxian❤️ side ship 💛mingyao🗡 side ship 🐇zhuiling🤬 side ship
You may also like
Slide 1 of 10
Not The Wei Ying Of The Past cover
Reverse Time cover
THE PRINCE'S MATES cover
The Ultimate and the Immortals cover
PETRONIUS(BXB){ COMPLETED} cover
Complications (MxM) cover
MDZS: The Mount's angel cover
Wei Wuxian: The Primordial Abyss cover
Back From The Dead With Secret cover
only "cultivation partners" | 🐇XICHENG🌸 cover

Not The Wei Ying Of The Past

12 parts Complete

When Wei Ying removed his hand from Lan Zhan hand, he look up at Lan Zhan, he can see the hurt, the sadness and how devastated Lan Zhan is when he see the person he love the most is falling down to the abyss below him. While falling down toward the abyss below him one thing went through his mind, 'Lan Zhan, if I could have one wish....I wish that I got the chance to tell you that I love you. If there is a chance for me to change the past then I will change everything. I'm sorry my Hanguang Jun.' Will Wei Ying be who he is in the future or will he change himself? Let's find out shall we. This is another Wei Wuxian dominated over Lan Wangji.

More details