غلاف قصة ANIME RECOMMENDATIONS بقلم Zaryswell
ANIME RECOMMENDATIONS
Zaryswell
  • WpView
    مقروء 701
  • WpVote
    صوت 99
  • WpPart
    فصول 52
  • WpHistory
    الوقت 43m
  • WpView
    مقروء 701
  • WpVote
    صوت 99
  • WpPart
    فصول 52
  • WpHistory
    الوقت 43m
Zaryswell
مستمرّة، تم نشرها في يونـ ٠٧, ٢٠٢٠
actionaddictinganimebestbllovebxbcomedydramafantasyhandpickedhighschoolmagicmoviespopularrecommendationsromanceseriesshoujoshounenshounenaisliceoflifeyaoi
The best anime recommendations resides in this book!!! 
Nothing less than life changing. 
And too good to be true. 
All the anime series and movies here are my favorite ones , the ones that I liked too much.
Hope you enjoy them all!!
جميع الحقوق محفوظة
actionaddictinganimebestbllovebxbcomedydramafantasyhandpickedhighschoolmagicmoviespopularrecommendationsromanceseriesshoujoshounenshounenaisliceoflifeyaoi
الفهرس

52 فصلا

قم بالتسجيل كي تُضيف ANIME RECOMMENDATIONS إلى مكتبتك وتتلقى التحديثات
أو
#1handpicked
إرشادات المحتوى
قد تعجبك أيضاً
The Modern Countess بقلم AlexiaPraks
87 أجزاء مكتمِلة
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
Haunted King بقلم cocopuffs9
47 أجزاء مكتمِلة للبالغين
"Is love supposed to feel this intoxicating?" ••• ⚠️TW: depictions of SA. Crude language. Violence. YANDERE ML! Read with care! ** means sex scenes ••• The dark and twisted romance of college student, Melody Lu, and the king of the Ashe Kingdom, Gabriel Ashe. Melody has always had a bad habit of getting too attached to fictional characters. From animes to novels, she has fallen for boy after boy. This is until she finds 'Fallen Angel,' a popular dating game because of it's male lead, Gabriel Ashe. Gabriel is a cold and tortured soul who has only ever found solace in the company of y/n. However, no one has ever managed to win the game. No one has ever been able to completely win the love of this cruel king. That is until Melody truly falls for the fictional character, and through her new found addiction to this dating game manages to successfully win him over. "100% Affection!" "Do you want to continue the story?" [YES] [NO] "YES" "Loading..." "Complete." "Transferring to 'Fallen Angel' " The haunted king has found his savior. And he has no plans of letting her go anytime soon. Haunted King, an isekai dark romance. ••• Started: March 20, 2023 4:17pm Finished: May 10, 2023 5:23am ••• NONE of the art in this book is mine! This is an ORIGINAL novel that is UNEDITED!! ••• #1 otome #1 monarchy #1 isekai #1 melody #1 wizardsandwitches #1 sadistic #1 sliceoflife #1 swordfighting #2 eroticromance #2 emperor #2 lovestory #2 villain #2 magicalcreatures #2 swordandsorcery #3 yandere #3 otome #6 possessive #12 pirates #146 romance
Just let me sleep! بقلم Seojun_hyung
23 أجزاء مستمرّة
She was just an innocent little girl who was starved for her family's love. Yet, they chose another young girl to be their happiness and threw her into a political marriage with North's monster-like prince. As she was on her way to her husband-to-be, she was faced with a mysterious monsters attack and experiencing her first feeling of happiness and care as she died. But she was send back in time where she is only 4 years old and apparently a boy? "Just leave me to sleep already!" She chose to live a lazy life but those annoying kids just wont leave her alone! Will she live peacefully and carefree this time?
Sweet Details|| Various Anime Characters x Reader (One-shot compilation) بقلم glumstars
39 أجزاء مكتمِلة للبالغين
[Note: This is a poorly written series of one-shots, grammatical and typographical errors.] A series of one-shots with different anime characters, because dreaming and imagining these moments with them was never considered as a bad thing.
𝑾𝑯𝑬𝑵 𝑻𝑯𝑬 𝑾𝑰𝑵𝑫 𝑩𝑳𝑶𝑾𝑺 •𝒃𝒙𝒃• بقلم _HIGEKI_
115 أجزاء مكتمِلة للبالغين
|| 𝐂𝐎𝐌𝐏𝐋𝐄𝐓𝐄𝐃 || • 𝑼𝑪𝑯𝑰𝑯𝑨 𝑺𝑨𝑺𝑼𝑲𝑬 • ᴡʜᴏ ᴡᴏᴜʟᴅ ʜᴀᴠᴇ ᴛʜᴏᴜɢʜᴛ ᴛʜɪɴɢꜱ ᴡᴇʀᴇ ɢᴏɪɴɢ ᴛᴏ ᴇɴᴅ ᴜᴘ ʟɪᴋᴇ ᴛʜɪꜱ? ʜᴇ ᴄᴇʀᴛᴀɪɴʟʏ ᴅɪᴅɴ'ᴛ. ᴛʜᴇ ꜱᴍᴏᴋᴇ, ᴛʜᴇ ꜰɪʀᴇ, ᴛʜᴇ ᴀꜱʜ. ʜᴇ ꜰᴇʟᴛ ᴇᴠᴇʀʏᴛʜɪɴɢ, ᴀʟʟ ᴀᴛ ᴏɴᴄᴇ. ᴀɴᴅ ᴛʜᴇɴ, ᴘᴀɪɴ. ᴘᴀɪɴ ᴡᴀꜱ ᴀʟʟ ʜᴇ ᴄᴏᴜʟᴅ ꜰᴇᴇʟ. ᴘʜʏꜱɪᴄᴀʟ ᴀɴᴅ ᴇᴍᴏᴛɪᴏɴᴀʟ, ɪᴛ ᴏᴠᴇʀᴡʜᴇʟᴍᴇᴅ ʜɪꜱ ꜱᴇɴꜱᴇꜱ, ᴜɴᴛɪʟ ʜᴇ ꜰᴇʟᴛ ɴᴏᴛʜɪɴɢ. ᴀ ᴅᴇᴇᴘ ᴅᴀʀᴋ ʜᴏʟᴇ ɪɴꜱɪᴅᴇ ʜɪᴍ ᴛʜᴀᴛ ᴡᴀꜱ ꜱᴏᴏɴ ꜰɪʟʟᴇᴅ ᴡɪᴛʜ ᴛʜᴇ ᴇᴍᴏᴛɪᴏɴ ʜᴇ ᴡᴀɴᴛᴇᴅ ᴛᴏ ᴋᴇᴇᴘ ᴀᴛ ʙᴀʏ; ʀᴀɢᴇ. ɪᴛ ᴡᴀꜱ ʀᴇʟᴇᴀꜱᴇᴅ ᴀɴᴅ ɪᴛ ꜱᴡᴀʟʟᴏᴡᴇᴅ ᴇᴠᴇʀʏᴛʜɪɴɢ ᴀʀᴏᴜɴᴅ ʜɪᴍ ɪɴ ᴀ ꜱᴡɪʀʟ ᴏꜰ ʀᴇᴅ. ʙᴜᴛ, ʟᴇᴛ ᴜꜱ ꜱᴛᴀʀᴛ ᴀᴛ ᴛʜᴇ ʙᴇɢɪɴɴɪɴɢ, ᴡɪᴛʜ ᴀ ᴘᴀɪʀ ᴏꜰ ᴛᴡɪɴꜱ, ꜱᴏ ᴅɪꜰꜰᴇʀᴇɴᴛ ꜰʀᴏᴍ ᴏɴᴇ ᴀɴᴏᴛʜᴇʀ. ʟᴇᴛ ᴜꜱ ꜱᴛᴀʀᴛ ᴡɪᴛʜ ᴜᴢᴜᴍᴀᴋɪ ᴀᴋᴀꜱʜɪ.
The Duke's Daughter's Third Life بقلم notwhippedhours
81 أجزاء مستمرّة
Aeliana was born into a Duke household as the only daughter and the youngest child, and at the age of four, on her birthday her previous life memories returned after surviving a near-death experience. In her first life, she was a simple office worker and the oldest in her family. In her second life, she had been reincarnated but became a shut-in, never leaving her room unless it was for meals. Yet, she died at the young age of 17, full of regrets. When she opened her eyes, she returned to her four-year-old self. Aeliana, wanting to change her life, decided to go out of her comfort zone, trying to fix her mistakes and regrets made in her second life. And the one regret she had was never growing close to her family, especially her brothers. However... 1st brother; "Get away from me." 2nd brother; "Don't talk or look at me." 3rd brother; "I hate you!!" 4th brother; "...." None of them liked her. Art cover by ahkinie (Instagram) This is my own story! I did not copy from anyone. The characters are my own that I made as well. This book is published on Tapas & Webnovel as well!
Body on me| Suguru Geto بقلم silvina_777
18 أجزاء مكتمِلة
"𝚋𝚊𝚋𝚢, 𝚕𝚎𝚝'𝚜 𝚌𝚞𝚝 𝚍𝚘𝚠𝚗 𝚝𝚑𝚎 𝐥𝐢𝐠𝐡𝐭𝐬, 𝙸 𝚓𝚞𝚜𝚝 𝚛𝚎𝚊𝚕𝚕𝚢 𝚠𝚊𝚗𝚗𝚊 𝚕𝚎𝚝 𝚝𝚑𝚒𝚜 𝚏𝚒𝚛𝚎 𝚋𝚞𝚛𝚗 𝐛𝐫𝐢𝐠𝐡𝐭, 𝙸'𝚖 𝚓𝚞𝚜𝚝 𝚝𝚎𝚕𝚕𝚒𝚗𝚐 𝚢𝚘𝚞 𝚝𝚘 𝚑𝚊𝚟𝚎 𝚊𝚗 𝚘𝚙𝚎𝚗 𝚖𝚒𝚗𝚍, 𝚓𝚞𝚜𝚝 𝚒𝚖𝚊𝚐𝚒𝚗𝚎 𝐮𝐬. 𝚈𝚘𝚞'𝚛𝚎 𝚝𝚊𝚔𝚒𝚗𝚐 𝚖𝚎 𝚝𝚑𝚎𝚛𝚎, 𝚢𝚘𝚞'𝚛𝚎 𝚝𝚊𝚔𝚒𝚗𝚐 𝚖𝚎 𝚝𝚑𝚎𝚛𝚎, 𝚘𝚞𝚛 𝚕𝚒𝚙𝚜 𝚊𝚛𝚎 𝚋𝚊𝚛𝚎𝚕𝚢 𝐭𝐨𝐮𝐜𝐡𝐢𝐧𝐠, 𝚜𝚘 𝚍𝚘 𝚒𝚝 𝚊𝚐𝚊𝚒𝚗, 𝚍𝚘 𝚒𝚝 𝚊𝚐𝚊𝚒𝚗, 𝚠𝚎 𝚌𝚘𝚞𝚕𝚍 𝚋𝚎 𝐨𝐧 𝐭𝐨 𝐬𝐨𝐦𝐞𝐭𝐡𝐢𝐧𝐠" High school sweethearts. This is how I can describe our relationship. It was sweet and cute, he was the perfect boyfriend. It was all like a dream, like a movie even. But every movie has an ending. And unfortunately not every ending is beautiful. !!warnings!! -spoiler free. -the plot is the only thing I own. The arts and the characters doesn't belong to me. -Fluff, Smut, Angst. 🖤completed🖤
Expressionless Awakener بقلم Alexasuracats
52 أجزاء مستمرّة
[ 🛑: Some chapters are old than the current chapters, So it may contain mispellings and confusing plot scenes or scenarios🛑 ] Johnson Kim, Real name; Kim Lee A 20 years old expressionless solo music artist (with a very absent-minded personality) reincarnated into a fantasy game-like world after dying from a car accident. He didn't know he reincarnated into a fantasy novel named; *Novel reincarnation* Until he realized it by accidentally going into the world's most powerful and famous Academy as a scholarship after losing a bet with his step-brother. Unfortunately, he already forgot most of the plots and storylines except (Some) of the characters in the novel. Since he already liked his normal life, He decided to avoid the characters and the storyline on purpose. Until he accidentally got drunk from a party that happens to be a plot scene in the novel two years later. Will Kim Lee still be able to lead a normal life or will the story change because of his existence in the novel? Story idea and characters are inspired by; [ ORV ] [ Omnicient reader's viewpoint ] Another Story Idea inspired by; [ Mashle magic and muscles ] {Original idea, please do not steal.}
I! The Villainess بقلم _Emerald_Witch_
34 أجزاء مكتمِلة
• What if you got into a book and woke up as a character in that book? • Well... this is the story of a girl who has a depressing life getting a second chance to live but as the character she admires from her favourite book 'love in spring'. • Will she continue to live more depressing days no different as her real life? will she able to do what she loves and couldn't do in her previous life? ∆ READ THE STORY TO FIND OUT! ∆
قد تعجبك أيضاً