Story cover for ANIME RECOMMENDATIONS by Zaryswell
ANIME RECOMMENDATIONS
Zaryswell
  • WpView
    LECTURAS 700
  • WpVote
    Votos 99
  • WpPart
    Partes 52
  • WpHistory
    Hora 43m
  • WpView
    LECTURAS 700
  • WpVote
    Votos 99
  • WpPart
    Partes 52
  • WpHistory
    Hora 43m
Zaryswell
Continúa, Has publicado jun 07, 2020
actionaddictinganimebestbllovebxbcomedydramafantasyhandpickedhighschoolmagicmoviespopularrecommendationsromanceseriesshoujoshounenshounenaisliceoflifeyaoi
The best anime recommendations resides in this book!!! 
Nothing less than life changing. 
And too good to be true. 
All the anime series and movies here are my favorite ones , the ones that I liked too much.
Hope you enjoy them all!!
Todos los derechos reservados
actionaddictinganimebestbllovebxbcomedydramafantasyhandpickedhighschoolmagicmoviespopularrecommendationsromanceseriesshoujoshounenshounenaisliceoflifeyaoi
Tabla de contenidos

52 partes

Regístrate para añadir ANIME RECOMMENDATIONS a tu biblioteca y recibir actualizaciones
O
#3handpicked
Pautas de Contenido
Quizás también te guste
I! The Villainess de _Emerald_Witch_
34 partes Concluida
• What if you got into a book and woke up as a character in that book? • Well... this is the story of a girl who has a depressing life getting a second chance to live but as the character she admires from her favourite book 'love in spring'. • Will she continue to live more depressing days no different as her real life? will she able to do what she loves and couldn't do in her previous life? ∆ READ THE STORY TO FIND OUT! ∆
Clueless (BL) de RottenGirlsFandom
5 partes Concluida
A boy meets a girl online...
The princess refuses to die de JustBelowAndAbove
33 partes Concluida Contenido adulto
A girl who only got shown hatred and disgust, she dies at the hands of her adoptive sister that everyone knows and loves. Her sister is from a place called Japan not only that she looks exactly like her mom!? After her death she wakes up to find people just like her sister and that her life that she has lived twice now was nothing but a lie!? But sometimes she can remember something that's never happened to her before...
Just let me sleep! de Seojun_hyung
23 partes Continúa
She was just an innocent little girl who was starved for her family's love. Yet, they chose another young girl to be their happiness and threw her into a political marriage with North's monster-like prince. As she was on her way to her husband-to-be, she was faced with a mysterious monsters attack and experiencing her first feeling of happiness and care as she died. But she was send back in time where she is only 4 years old and apparently a boy? "Just leave me to sleep already!" She chose to live a lazy life but those annoying kids just wont leave her alone! Will she live peacefully and carefree this time?
Can You Hear My Heart? (BXB) de Squidtcyc
38 partes Concluida Contenido adulto
What if you died yet you're given a second chance to live your life? Not as yourself but in another person's body, living his life? What drama will you face? Are you able to uncover the secrets behind the cause of the person's death? Can you...live again?
Pretending to be a noob in a world scaled by power level de Swordmaster7777
192 partes Concluida
As one of the strongest adventurers in the world, I pretended to be a F tier noob, so I can restart my adventure all over again.
The Modern Countess de AlexiaPraks
87 partes Concluida
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
Haunted King de cocopuffs9
47 partes Concluida Contenido adulto
"Is love supposed to feel this intoxicating?" ••• ⚠️TW: depictions of SA. Crude language. Violence. YANDERE ML! Read with care! ** means sex scenes ••• The dark and twisted romance of college student, Melody Lu, and the king of the Ashe Kingdom, Gabriel Ashe. Melody has always had a bad habit of getting too attached to fictional characters. From animes to novels, she has fallen for boy after boy. This is until she finds 'Fallen Angel,' a popular dating game because of it's male lead, Gabriel Ashe. Gabriel is a cold and tortured soul who has only ever found solace in the company of y/n. However, no one has ever managed to win the game. No one has ever been able to completely win the love of this cruel king. That is until Melody truly falls for the fictional character, and through her new found addiction to this dating game manages to successfully win him over. "100% Affection!" "Do you want to continue the story?" [YES] [NO] "YES" "Loading..." "Complete." "Transferring to 'Fallen Angel' " The haunted king has found his savior. And he has no plans of letting her go anytime soon. Haunted King, an isekai dark romance. ••• Started: March 20, 2023 4:17pm Finished: May 10, 2023 5:23am ••• NONE of the art in this book is mine! This is an ORIGINAL novel that is UNEDITED!! ••• #1 otome #1 monarchy #1 isekai #1 melody #1 wizardsandwitches #1 sadistic #1 sliceoflife #1 swordfighting #2 eroticromance #2 emperor #2 lovestory #2 villain #2 magicalcreatures #2 swordandsorcery #3 yandere #3 otome #6 possessive #12 pirates #146 romance
Yaoi Bitch! Males x Male Reader! one-shots! de Rocket-Shines
38 partes Concluida Contenido adulto
This is for all of us who are a Yaoi Bitch, a little Fan Fiction of you and male characters (if your a girl ur welcome to join this crazy adventure but keep in mind your a boy). Request will be open until the day I die! Hope you enjoy this crazy adventure!
Quizás también te guste
Slide 1 of 9
I! The Villainess cover
Clueless (BL) cover
The princess refuses to die cover
Just let me sleep! cover
Can You Hear My Heart? (BXB) cover
Pretending to be a noob in a world scaled by power level cover
The Modern Countess cover
Haunted King cover
Yaoi Bitch! Males x Male Reader! one-shots! cover

I! The Villainess

34 partes Concluida

• What if you got into a book and woke up as a character in that book? • Well... this is the story of a girl who has a depressing life getting a second chance to live but as the character she admires from her favourite book 'love in spring'. • Will she continue to live more depressing days no different as her real life? will she able to do what she loves and couldn't do in her previous life? ∆ READ THE STORY TO FIND OUT! ∆

Más detalles