Story cover for Far Away by Thenameisamor
Far Away
Thenameisamor
  • WpView
    Reads 4
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time <5 mins
  • WpView
    Reads 4
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time <5 mins
Thenameisamor
Ongoing, First published Jun 22, 2020
awaydespairfantasyfarmagemagictimetimetraveltransformationtravel
Years had passed after a terrible incident in Sagheim Islands that greatly affected many inhabitants. 
Before the incident, a certain unusual group of  people had formed a bond. One of them was Yumi, a mage. She is one of the inhabitants of the island who survived that terrible incident. Years passed, Yumi is still hoping that her friends survived. She was about to give up but because of an unknown cause, Yumi was transported back in time. 
Can she change the terrible fate that was set on her and her companions?
Public Domain
awaydespairfantasyfarmagemagictimetimetraveltransformationtravel
Table of contents

1 part

Sign up to add Far Away to your library and receive updates
or
#206despair
Content Guidelines
You may also like
Terribly Twisted by starrygalunchxie
20 parts Ongoing Mature
In a terribly twisted battle of all is fair in love and war, friends will turn to each other looking for their fated. Broken hearts from the past will twist the hearts of those in the present. Will the people obey the Fates or fight for their hearts? Yumi was lost because of greedy love. Liam was almost lost and stripped of his rightful place. Will Kevin be able to hide forever? Who is behind this terrible twist of fate? Will they be able to redeem themselves and save the present? REVISION UNDERWAY
Future Magi (Magi Fanfiction) by alexinwhite
34 parts Complete
*I do not own Magi or any of it's characters* Several hundred years after the Kou Empire civil war, Al-Thamen is completely defeated. The battle was long and hard, leaving most of the word in ruins. The normal humans, who later call themselves MWS (Magic-weilders Subjugation Organization) decide that magicians and metal vessel users are far too strong, too dangerous. The MWS begin locking up any race that had power. Magicians, dungeon capturers' djinn, household users, magi, and even the Fanalis and Imuchakk. Once they were finished, they united the world, making it all one country, and genetically mutated humans to be sure no magicians were born... Despite all this, one magi survived. Neah, a twenty four year old still in her senior year of high school, with an arrogant personality. She's also the only fallen member of society, another thing MWS tried to fix, but couldn't with her. Neah's vowed to save her fellow magicians, seeing it as her duty being the last free magi...but it doesn't exactly go as planned... (40K words)
The Legion || Volume 2 of The Legion series by valkyrii
15 parts Complete Mature
❝I was never meant to be her.❞ ❝Then who are you really meant to be?❞ The war between Madison and Jaden has finally ended. The war was long but it had an outcome no one truly expected. One month later after the war, the remaining members of the Legion run into personal problems regarding what happened in the past and everyone is utterly torn. While most of the Legion won the war, some of them had to lose it. Their loss came with repercussions for the others and it is tearing everyone apart. Life for all of them isn't normal anymore and it never was until Madison arrived. How will things change for everyone and who will arise to become future opponents?
Yu-Gi-Oh Arc-V Rewrite: Extra by MilllingMachine67
6 parts Complete
Yuya awakens in an unfamiliar city. The city, although human, is much less advance than the human cities he was used to. Venturing through this city, Yuya meets a familiar face. With help from his new friend, Yuya regains the method to traverse dimensions. However, some of the dimensions he visits are not the Friendliest.
Into the Other World by _phiba_
56 parts Complete
An ordinary high school girl from the modern world one day wakes up in a different world full of wizards,sorcerers, a land of magic and there she faces many trails and dangers as she tries to find a way to get back to her own world. Will she be able to get back or will she be stuck in the magical world forever??
Not In This Dimension by cnicoll
16 parts Complete Mature
This is about a young sixteen girl from our dimension accidentally crossing over into Yusei's dimensions. She doesn't want to leave and feels like she belongs here instead of her world. She has adventures with Yusei and his friends, getting what she always wanted adventures and her freedom she will meet new friends experience a whole new adventure and face a dangerous new threat. And she will achieved new powers and gain strength of her friends and her new family.
Mysterious Time Traveler in Dwapara Yuga by Nishaku09
78 parts Ongoing
In the mystical era of Dwapara Yuga, there existed a mysterious time traveler-a girl who wove her existence through countless aliases, concealing her true name and identity. Only four individuals knew her intimately, forming an unbreakable bond that transcended lifetimes. Together, they navigated the ebb and flow of existence, from life to death and back again. Behind the veil of secrecy, she held immense power. Since her teenage years, she had subtly shaped the world, showing kindness to those who deserved it and unleashing wrath upon those who dared to cross her. To her loved ones, she appeared as an innocent child, her personality bubbling with warmth. But to outsiders, she emanated an enigmatic calmness-a silent force that could alter destinies. In an unexpected twist of fate, she found herself transported back to the era of great warriors-a time when valour clashed against destiny, and legends were forged in the crucible of battle. The catalyst for this temporal journey was a seemingly innocuous mistake made by someone she deeply cared for-a mistake that reverberated through the ages. She found herself reborn as the daughter of a benevolent king and queen. Three elder brothers surrounded her, their protective love shielding her from the tumultuous currents of fate. And so, she stepped into the annals of history, her modern sensibilities colliding with an ancient world.
The Epic From Her Eyes- Mahabharata by TheCryingSoul
48 parts Complete
Meet Amrit, a 19 year old Indian girl who went to the age of Mahabharata. But what will happen if the way she knew the Mahabharata is not exactly how it is? What will happen if she learn some things about her which she was unaware of? Moreover what changed would she bring to the epic? This is my first story so sorry for any mistakes. Thanks for 2K+ reads DISCLAIMER- THIS STORY IS COMPLETELY JUST A WORK OF FICTION. IT DOES NOT MEAN TO HURT ANYONE'S SENTIMENTS. THIS STORY IS JUST TO SHOW WHAT COULD HAVE HAPPENED BUT NOT ALL PARTS ARE TRUE. I HAVE TRIED TO STICK TO THE HISTORY AS MUCH AS POSSIBLE. THIS STORY MIGHT CONTAIN SOMW FOLKTALES AND SOME STORIES OF MY OWN IMAGINATION. All Rights Are Reserved.
spirited away 2: Return to the spirit world by XxDeathsAngelxX
27 parts Complete
It's been 12 long years since Chihiro has been to the spirit world, and she wishes she never left. After years and years of trying to return to the spirit world and failing she is finally able to enter the spirit world again. She is so happy to see all her friends and people she consider her family and her one true love. Once again she is happy but will that happiness last forever or will it be short lived? Follow Chihiro's dangerous journey as she find a way to stay in the spirit world. And if there is a way to stay will she take the opportunity to stay in the spirit world and leave everything behind in the human?
You may also like
Slide 1 of 9
Terribly Twisted cover
Future Magi (Magi Fanfiction) cover
The Legion || Volume 2 of The Legion series cover
Yu-Gi-Oh Arc-V Rewrite: Extra cover
Into the Other World cover
Not In This Dimension cover
Mysterious Time Traveler in Dwapara Yuga cover
The Epic From Her Eyes- Mahabharata cover
spirited away 2: Return to the spirit world cover

Terribly Twisted

20 parts Ongoing Mature

In a terribly twisted battle of all is fair in love and war, friends will turn to each other looking for their fated. Broken hearts from the past will twist the hearts of those in the present. Will the people obey the Fates or fight for their hearts? Yumi was lost because of greedy love. Liam was almost lost and stripped of his rightful place. Will Kevin be able to hide forever? Who is behind this terrible twist of fate? Will they be able to redeem themselves and save the present? REVISION UNDERWAY

More details