Story cover for Dagger Series #4: Unadorned by MsButterfly
Dagger Series #4: Unadorned
MsButterfly
  • WpView
    Reads 927,347
  • WpVote
    Votes 36,343
  • WpPart
    Parts 41
  • WpView
    Reads 927,347
  • WpVote
    Votes 36,343
  • WpPart
    Parts 41
MsButterfly
Complete, First published Jul 04, 2020
Mature
actionbodyguardcomedycrimedetectivedramafilipinofriendstolovershumorlovemsbutterflyreunitedromanceromcomslowburnsupermodeltagalogtagaloglovestory
Being on top is second nature for the renowned supermodel, Mireia Aguero. She literally needed to be on top to get where she is now. On top of a bed? Sports car? Billiard table? Kitchen counter? Mini bar? Name it. 

Her world expanded in the same way that her wardrobe scaled up. Mireia Aguero became the name that anyone in the industry recognized. But fame comes with risks. The fashion industry was suddenly rattled by the death of a model. It opened questions that led to more sinister speculations.

Her best friend hired a bodyguard for her. Axel Dawson. The sweet boy that she knew years ago.

In her world, the spotlights are illuminating her path, the runway is her domain, the extravagant dresses are her armor, and with her face made up... she conquer the world. If at the end of the day, she take down the shield, sheath away her protection with her war paint cleaned off her, leaving her bare and unadorned... it won't be in a way that he would see.

Because he might be the same boy inside the man that he is now, but she is no longer the girl that she once was.

Not anymore.
All Rights Reserved
actionbodyguardcomedycrimedetectivedramafilipinofriendstolovershumorlovemsbutterflyreunitedromanceromcomslowburnsupermodeltagalogtagaloglovestory
Table of contents

41 parts

Sign up to add Dagger Series #4: Unadorned to your library and receive updates
or
Content Guidelines
You may also like
Versailles Series: The Bodyguard [COMPLETED] by MarieCallie19
65 parts Complete Mature
Patch She's cold and unfeeling which makes her the best agent ever After getting a head of herself, she gets sent to an insufferable mission Be a pretend girlfriend of some handsome governor in a small town Kylo is just another mission she needs to accomplish Will he just be a job that needs protection or will she be needing the protection this time? Kylo A promising young leader under the threat of an unknown enemy Patch stands with him as his bodyguard and girlfriend undercover But the more he breaks into the wall she surrounded herself in, the more he sees the woman behind the scars Will the act slowly turn into something more than just a pretense? This story is written in Tagalog/English. R-18 (SPG) *** WARNING: This story contains flawed characters. *** DISCLAIMER: No part of this manuscript may be reproduced or transmitted in any form or by any means, electronic or mechanical, including photocopying, recording or by any information storage and retrieval system, without written permission from the author. This is a work of fiction. Names, characters, businesses, places, events and incidents are either the products of the author's imagination or used in a fictitious manner. Any resemblance to actual persons, living or dead, or actual events is purely coincidental. ***
Monasterio Series #1: Lies Beneath Her Love by Warranj
59 parts Complete Mature
Adrianna Monteverde did what every stubborn daughter forced to marry a stranger would have done--she ran away. But as she spun lies upon lies about her identity in order to protect her freedom, she did not know that finding love while under a false identity would come at a great cost: Happiness. ******* Despite the love she has for her parents, Adrianna finally had enough the moment she learned of the marriage they arranged with a complete stranger, even if it's for their family's business. She decided to run away, but never in her wildest dreams did she imagine that hiding inside the trunk of an unknown car would lead to her becoming a maid, and worse, falling in love with its owner. But her fears got the best of her and she was forced to lie about everything--her name, her profession, even her family--and as they say, no lie can live forever. Would Adrianna be willing to remove her mask of lies and secrets even if revealing her real identity might lead to her downfall? Disclaimer: This story is written in Taglish Cover Designed by Cil Ojumo
Why Did We Meet Again? (Flavors of Love #1) by ForcingLaughter01
33 parts Complete
Bad idea talaga ang mga class reunions, lalo na kapag gusto mong iwasan 'yung EX mong hindi mo makalimutan! So much can change after 8 years. The stress of senior high school, pressure in college years, busy schedules, and devastating break-up -- lahat ng 'yan ay nalampasan ni Merielle. She's grown into a fine, strong, business-minded woman despite so many failures in the past. She's ready to take on whatever life has to throw her. Ang kaso lang, hindi siya ready na makita ulit ang taong dumurog sa kanya many moons and suns ago. Consumed by love and hatred, Merielle promised herself not to be affected by him anymore. No matter how gorgeous Damian could be. But how can she do that, when both fate and strong magnetic field of a force always get them closer? FLAVORS OF LOVE 1.
The Lieutenant's Brat Girlfriend by munchy1290
47 parts Complete Mature
"I-I'm the first lieutenant of the Air Force and you should obey me whether you like it or not!" - Lacey Halverson "Well I'm the first daughter of my daddy so whether you like it or YOU will like it, you'll obey me." - Selina Dawson "Tsk. W-what a brat." - Lacey Halverson Lacey Halverson is the sister of Yulo that has been sent out from her country to join the Air Force as a Lieutenant. Awkward siyang tao at tahimik. But when she met Selina as her housemate, they're always having an argument whenever they sees each other. Ganyan na nga lang ba sila all the way through the end? Or may mabubuong pagi-ibigan sa pagitan nilang dalawa? This is a work of fiction. Names, characters, businesses, places, events and incidents are either the products of the author's imagination or used in a fictitious manner. Any resemblance to actual persons, living or dead, or actual events is purely coincidental.
The Girl He Never Wanted [Completed] by ella_tgg
45 parts Complete Mature
WARNING: R-18 Synopsis How would you tell your story if you are the intrusive party who rudely swerved into the lane of lovers? Would people even hear it? 
"I want nothing to do with you, Ella," he formally informed her. 
"I know. I have always known," she answered as she plastered the sweetest smile to assure him this is not new information to her either. Then she stepped out of his office, maybe out of his life forever. Setting: Cebu Bacolod Dapitan Disclaimer

This is a work of fiction. Unless otherwise indicated, all the names, characters, businesses, places, events and incidents in this book are either the product of the author's imagination or used in a fictitious manner. Any resemblance to actual persons, living or dead, or actual events is purely coincidental. Drafted: 2015 Started: July 25, 2021 Completed: August 20, 2021
Dagger Team Series #1: Sorcha's Hearth by MsButterfly
43 parts Complete Mature
Sorcha Byrne and her twin used to love mythology when they were little. Their parents will tell them stories about the different gods and goddesses, and naturally, her twin brother's favorite is the King of the Gods, Zeus. But she was more drawn to Hestia. The goddess of the hearth, home, and family. While Hestia was most known for tending the hearth and ensuring the well-being of her community, that wasn't what made Sorcha interested in her. It was the fact that she's wise enough to keep to herself, stay in a quiet place, and save herself from all the dramas around her. She's the greatest unbothered queen, and Sorcha see herself in her. The only difference is that their hearths are far different from one another. She's like a frosty version of Hestia. Not that she's unfeeling or anything. She's just more comfortable with ignoring everything around her. Since she makes no effort to try to understand the world outside of her own, it wasn't surprising that it's now causing her problems. So here she is facing a dilemma since her no-nonsense attitude is causing problems at work. She was expecting to get fired, but the Dawson siblings are really good employers. As a compromise, they propose an interpersonal skills training just for her. She just need to take on a small special case where she will be shadowed to mentor someone in the ins and outs of her daily job. Wala naman sanang problema. It's supposed to be easy... except it wasn't. Not when the person she's "babysitting" is far from the idea she have of a wide-eyed student, and instead she's going to be stuck for ninety hell days with Darien Zeon Henderson, also known as Daze, a famous actor who is currently preparing for a role he's going to play. Ninety days? Damn it. Someone just please burn me and sacrifice me to the gods and goddesses, or it would be Daze Henderson that I will offer as one!
Taste Of Sin: Playing By The Rules (Under Revision) by FoxyKitten24
124 parts Complete Mature
"I'm gonna bone you hard for the whole day today until you're utterly spent," He said with his gaze darkened "You're not allowed to rest until I say so." She gulped hard by the thought of it, she was speechless like her throat gone dry all of a sudden as her heart began beating faster With a dark smirk, he put his hand on the string of her underwear and Immediately pulled it, giving it a snapping sound, it sting her a bit, making her gasp as he leaned to whisper at her ear "Better be ready 'cause I'll make sure to fuck you in every corner of this house and I would never stop even if you beg me to." His words makes her tremble like she suddenly felt weak on her knees Can the good girl possibly resist his urges or will she give in? The miss goody two shoes of ravenwood, Blair Adelson or "The boring one" who constantly making fun of by everyone because of her lack of style has caught the eye of the dangerous and ruthless rumored heir of the mafia, Jaxon Ashford. Known as the heartless bad boy of ravenwood high, the school for the wealthiest elites of Los Angeles, In which blair doesn't fit in as they treated her like a laughing stock and a walking meme but unbenknownst to them, blair already caught the bad boy's attention with her naiveness, innocence and strong willpower that piqued his curiousity and If there's something he's good at, one of 'em is making any girl fall on his feet with just his stare alone. Knowing him, he would never stop until he get what he wants but, what if her innocence is what he wanted? Could she run away from danger before it's too late? Or could she chase away his demons? Warning! This story contains drugs, cursing, detailed sex scenes. This is not your ordinary love story. You've been warned. #1 in badboy #1 in tagalog-english # 1 in taglish #1 in tagalog #16 in scandal
The Billionaire's Wrath by HiroYuu101
62 parts Complete Mature
Miss Prim and Proper and the university's top student Daphne Madrigal has a secret that can destroy her perfect image. But what if the university's notorious playboy discovers it? Will she agree to his deal in exchange for staying quiet--or will she finally have the courage to show her true self? -- All her life, Daphne Madrigal wants to be respected by everyone--especially by her mother--so she did everything to be perfect in their eyes. But Miss Prim and Proper also has secrets that can ruin her perfect reputation. Unfortunately, Apollo Gallagher, her best friend's overprotective twin brother and the most notorious playboy of their university, discovers it. To keep him quiet, she strikes an unlikely deal with him. Will this help her release her true self, the 'her' she's been suppressing from the very beginning? Or will this only add more pain to her lonely life? Disclaimer: This story is in Taglish Cover Designer: Anastasia Wright -- Originally HIDING FROM THE BILLIONAIRE'S WRATH
Dagger Series #5: Unbowed by MsButterfly
41 parts Complete Mature
People call Ember Nile Calderon a lot of things. Sometimes it's the Huntress, Queen of Arrows, the Archeress, or the Lonely Wolf. Those she don't mind. After all, she's one of the most decorated archers of her time. She's a two-time defending champion for Archery World Cup and World Archery Championships for recurve and compound, and she's also a two-time Olympic gold medalist. But lately, some of the names she's being called are getting on her nerves. The NBSB, the frigid snob, the unlikable bitch, the passionless princess, the woman who'll end up marrying her arrow since it's the only "stick" that she will ever see in her life. The media and the people keep on branding her as an undesirable woman. It's infuriating but she doesn't care, however, her agent and her sponsors do. "Dear universe, ang unang lalaking lalapit sa akin ngayong gabi ay hahalikan ko." Alcohol and frustration is not a good combination. In a poor-lit bar, with drinks that are too many to count, she found herself challenging destiny. Just for one night of fun. But apparently the man that she just met is bound to cross her path again, because Trace Dawson has his own deal with the universe. "Dear universe, ang susunod na babaeng hahalikan ko ay si The One na."
You may also like
Slide 1 of 9
Versailles Series: The Bodyguard [COMPLETED] cover
Monasterio Series #1: Lies Beneath Her Love cover
Why Did We Meet Again? (Flavors of Love #1) cover
The Lieutenant's Brat Girlfriend cover
The Girl He Never Wanted [Completed] cover
Dagger Team Series #1: Sorcha's Hearth cover
Taste Of Sin: Playing By The Rules (Under Revision) cover
The Billionaire's Wrath cover
Dagger Series #5: Unbowed cover

Versailles Series: The Bodyguard [COMPLETED]

65 parts Complete Mature

Patch She's cold and unfeeling which makes her the best agent ever After getting a head of herself, she gets sent to an insufferable mission Be a pretend girlfriend of some handsome governor in a small town Kylo is just another mission she needs to accomplish Will he just be a job that needs protection or will she be needing the protection this time? Kylo A promising young leader under the threat of an unknown enemy Patch stands with him as his bodyguard and girlfriend undercover But the more he breaks into the wall she surrounded herself in, the more he sees the woman behind the scars Will the act slowly turn into something more than just a pretense? This story is written in Tagalog/English. R-18 (SPG) *** WARNING: This story contains flawed characters. *** DISCLAIMER: No part of this manuscript may be reproduced or transmitted in any form or by any means, electronic or mechanical, including photocopying, recording or by any information storage and retrieval system, without written permission from the author. This is a work of fiction. Names, characters, businesses, places, events and incidents are either the products of the author's imagination or used in a fictitious manner. Any resemblance to actual persons, living or dead, or actual events is purely coincidental. ***

More details