Dagger Series #4: Unadorned
MsButterfly
  • Reads 785,718
  • Votes 34,457
  • Parts 41
  • Reads 785,718
  • Votes 34,457
  • Parts 41
MsButterfly
Complete, First published Jul 04, 2020
Mature
actionbodyguardcomedycrimedetectivedramafilipinofriendstolovershumorlovemsbutterflyreunitedromanceromcomslowburnsupermodeltagalogtagaloglovestory
Being on top is second nature for the renowned supermodel, Mireia Aguero. She literally needed to be on top to get where she is now. On top of a bed? Sports car? Billiard table? Kitchen counter? Mini bar? Name it. 

Her world expanded in the same way that her wardrobe scaled up. Mireia Aguero became the name that anyone in the industry recognized. But fame comes with risks. The fashion industry was suddenly rattled by the death of a model. It opened questions that led to more sinister speculations.

Her best friend hired a bodyguard for her. Axel Dawson. The sweet boy that she knew years ago.

In her world, the spotlights are illuminating her path, the runway is her domain, the extravagant dresses are her armor, and with her face made up... she conquer the world. If at the end of the day, she take down the shield, sheath away her protection with her war paint cleaned off her, leaving her bare and unadorned... it won't be in a way that he would see.

Because he might be the same boy inside the man that he is now, but she is no longer the girl that she once was.

Not anymore.
All Rights Reserved
actionbodyguardcomedycrimedetectivedramafilipinofriendstolovershumorlovemsbutterflyreunitedromanceromcomslowburnsupermodeltagalogtagaloglovestory
Table of contents

41 parts

Sign up to add Dagger Series #4: Unadorned to your library and receive updates
or
Content Guidelines
You may also like
Until the End of Time (Donovan Series #2) by xxmnixx
44 parts Complete Mature
Mari Gauxiena Donovan, a sophisticated yet impatient doctor, crossed paths with Captain Jaxon Alexander Ventura because of a mission in Afghanistan that made their two different worlds collide. She's used to saving people's lives; while he's used to sacrificing his life to save people. She holds a scalpel inside the operating room. He holds a gun every time he goes to war. She stays inside a hospital. He stays inside a battlefield. They were there for a mission, but little do they know that this mission will also include them... falling for each other. *** Inspired by Descendants of the Sun
An Oath To Take (Imperfect Girls Series #1) by zxantlyx
68 parts Complete
[Imperfect Girls Series #1] Getting married to a random stranger just because of a single mistake? That is what happened to Amaia Imogen Muñoz when she decided to find someone to sleep with in a dating app. She matched with a man, who's just like her, doesn't want any more commitment, Andre Percival Velasquez. One mistake that turned their whole life around, and ended up messing with their single happy life. Are they really ready to be tied to each other, together and forever, in the case of marriage? Genre: Romance Language: Tagalog-English Highest Rankings: #1 out 5.85k in filipino tags (12-20-2021) #33 out of 7.09k in tagalog (12-16-2021) #2 out of 2.04k in partners tag (12-19-2021) Credits: to @MsInsipid for helping with the title!!
Found Myself In You ✔ by mitixlda
43 parts Complete Mature
[ TO BE PUBLISHED ] He painted her soul with the colors of the rainbow, and she cherished his heart with her painted soul. Muriel desires the true meaning of art. She put her half-life on it, but when it comes to romance stuff she doesn't even care about it. She's afraid to commit her love and time to someone. So, she fixates herself on painting. An annoying and playful man will be her almost enemy, Ryker, and Muriel settled up herself on him. She will be able to take a risk, to desire him more than art, and to love him boundlessly. Date Started: April 14, 2020 Date Finished: May 30, 2020
Hard to Love (Villaraza Series #1) by rayawari
18 parts Complete
The brat and the naïve. The obsessed and the obsession. The chaser and the chased. Serafina H. Del Prado was infamous for being a brat, childish, attention seeker, and warfreak. She was loved and hated at the same time. She was carefree and didn't care what others thought of her. Not until she met the gorgeous Fernando Iñigo Ricaforte Villaraza and fell for him. Kilala ang panganay na Villaraza sa pagiging mailap at tahimik. He was her total opposite. However, that even made her wanting more of him. She felt it in her bones that he was the one she had been waiting for! She promised herself she would make him hers, whatever it would take. Oras na mapasakanya ang lalaki, hinding-hindi na ito titingin sa iba. The rejections, the pain. All of it. Titiisin niya, mapasakanya lamang ang lalaking iniibig. Hindi lamang dapat siya ang nababaliw, kundi pati rin ito. She would make sure they would both drown in love and no one could ever save them. She did everything, even the unimaginable. Akala niya ay malapit niya nang makuha ang loob nito. Pero nagkamali siya. He became more distant and colder towards her to her utter dismay. Mas lalo siyang naging uhaw sa atensyon nito - sa pag-ibig nito. She did everything, but Fernando Iñigo R. Villaraza was just too damn hard to love.
Bullet of Rules (Military Series 4) On-going by Krixtxxa
32 parts Ongoing
Abi, a typical teenager who is secretly in-love with her brother's best friend, Bullet. Yet, she believes he only sees her as nothing more than a little sister because of their age-gap. Driven by her feelings, Abi secretly joins the military to follow Bullet in the camp. As she immerses herself in the military training, she hopes to earn Bullet's attention and perhaps, his heart... again. The love she keeps in secret is ready to break the Bullet of Rules as they cross their path again. Military Series 4: Bullet of Rules DON'T PLAGIARIZED MY WORK!!!
Victoria's Harvested Love: Embracing Countryside Bliss by incesisa
34 parts Complete Mature
A city dweller yearning for a deeper connection, is drawn to the allure of the countryside. As she ventures into the sprawling landscapes, the fields unfold like a symphony of colors, mirroring the complexities of her inner world. The fields become a canvas for her personal growth, embracing her with heavenly peace and offering the space to explore her true self. Amidst wheat rustling and wildflowers dancing, Victoria's heart awakens to the harmonies of love that bloom against the fields' backdrop. In the breeze's gentle caress and the golden sunlight, she finds solace and connection with a kindred man who understands the language of the land. Their story unfolds amidst golden sunsets and starlit nights, each moment etching itself into the fabric of their hearts. As they tend to the land, sowing seeds and reaping the rewards of their labor, she discovers a sense of purpose and contentment. The simple joys of farm life, the warmth of the sun on her face, the earth beneath her fingertips, and the shared laughter in the fields with Eusebio become the foundation of their blossoming connection, proving that sometimes love found in the most unexpected places. Victoria learns that true fulfillment lies not in bustling city streets but in the gentle embrace of nature and the deep connections forged within her heart.
UNDER NO ILLUSION (Vander #2) by ShinichiLaaaabs
37 parts Ongoing
Vander #2 Cooler Vander 01042020 Genre: action, romance Cover image not mine. Credits to the rightful owner.
Les Solitaires by Yanalovesyouu
33 parts Ongoing
Still unable to accept Amber Lamperogue's death, Duchess, Katana, and the rest of Black Organization find ways to investigate what really happened before. But when they're faced with numerous roadblocks and confusing clues, can they really uncover the truth? *** Despite witnessing the death of Amber Lamperogue with her own eyes, Duchess Lionheart still believes that Amber is alive. With the sudden disappearance of Les Solitaires where Amber serves as one of the Jokers, Duchess and Katana are more determined to uncover the truth. The problem? All the information they get leads them to a dead end. When the rest of Black Organization start to team up and dig for more clues, can the mystery regarding Amber's death be revealed once and for all? Disclaimer: This story is written in Taglish. Cover Design by Louise De Ramos
Lost in an Island (Isla Vagues Series #4) by _lollybae_
10 parts Ongoing
Stalina Amaris Fontanez. She was crown as the queen of the waves, the slayer surfer of the sea. She is the living mermaid of the Isla Vagues, blessed with a beauty and graceful moves. Ang tubig at alon ay higit pa sa hangin para sa kanya, kailangan niya iyon para mabuhay. Ang gumalaw at sumamyo sa galaw ng alon ay nagpapaligaya sa kanyang puso. Tahanan niya ang karagatan na nakapalibot sa Isla Vagues. Isa siyang sirena na dapat manatali sa ilalim ng tubig, ang mawala sa kanyang tahanan at tumapak sa ibang kalupaan ay kamatayan. No one would make her leave her home no matter what. That was what she thought, until she met a man who was lost in the island. Will he still see the island a strange place if he was entice in the queen of the waves or Stalina will still can't leave her home after hearing his tempting voice?
My Husband is a Mafia Boss (Season 3) by Yanalovesyouu
127 parts Complete
Mikazuki convinces Bullet to meet his birth parents after being taken away by the former leader of the most powerful mafia group, Black Organization, for twenty-five years. But what if she later learns that their real families are in fact mortal enemies? Will Mikazuki dare to fight for their blossoming love--or will she choose to seek revenge? *** After staying in Japan for several years, Mikazuki finally convinces Bullet, her adopted brother, to go back to the Philippines and meet his birth parents after being taken away from them twenty-five years ago by Terrence Von Knight, the former leader of the most powerful mafia group, Black Organization. Things start to get more complicated as untold stories and secrets concerning their real parents unfold, and they discover Mikazuki's true connection with Terrence Von Knight. A battle between their hearts and priorities erupts. What will be Mikazuki's ultimate choice? DISCLAIMER: This is a story written in Taglish. COVER DESIGNER: April Alforque
You may also like
Slide 1 of 10
Until the End of Time (Donovan Series #2) cover
An Oath To Take (Imperfect Girls Series #1) cover
Found Myself In You ✔ cover
Hard to Love (Villaraza Series #1) cover
Bullet of Rules (Military Series 4) On-going cover
Victoria's Harvested Love: Embracing Countryside Bliss cover
UNDER NO ILLUSION (Vander #2) cover
Les Solitaires cover
Lost in an Island (Isla Vagues Series #4) cover
My Husband is a Mafia Boss (Season 3) cover

Until the End of Time (Donovan Series #2)

44 parts Complete Mature

Mari Gauxiena Donovan, a sophisticated yet impatient doctor, crossed paths with Captain Jaxon Alexander Ventura because of a mission in Afghanistan that made their two different worlds collide. She's used to saving people's lives; while he's used to sacrificing his life to save people. She holds a scalpel inside the operating room. He holds a gun every time he goes to war. She stays inside a hospital. He stays inside a battlefield. They were there for a mission, but little do they know that this mission will also include them... falling for each other. *** Inspired by Descendants of the Sun

More details