Child of a killer
Dakota661
  • Reads 42
  • Votes 1
  • Parts 3
  • Time 7m
  • Reads 42
  • Votes 1
  • Parts 3
  • Time 7m
Dakota661
Ongoing, First published Jul 08, 2020
actionthrillertvsdfanficvampirewerewolfwitch
Drip,drip,drip. That's all I heard on the worst night of my life. Screams of mother and father and wind blowing passed. I finally had the courage to walk out of the closet my parents had thrown me in for safety, when I finally walked out I all I saw was black except for his face. Jet black hair evil look in his eyes he almost looked like me. And then he was gone in two seconds.
Public Domain
actionthrillertvsdfanficvampirewerewolfwitch
Table of contents

3 parts

Sign up to add Child of a killer to your library and receive updates
or
#11tvsdfanfic
Content Guidelines
You may also like
Hecate's Gift (Ari & Soren Book 2) by OwlieCat
53 parts Complete
Ari and Soren's adventures continue as Soren struggles with his new vampiric urges and a coven of witches attempts to recruit Ari for their own ends. ***** As dark dreams plague Soren, Ari finds his new abilities difficult to control. Something is awakening within him, and as his power grows, he attracts the attention of a group of witches who call themselves the Hecataeon. They believe Ari is an emanation of the goddess Hecate - a physical manifestation of her power - and they want that power for themselves. With their relationship facing challenges from within, Ari and Soren must find a way to unite their strengths before external forces tear them apart. - NOTE: This book is the sequel to Bound by Blood. - Content Warning: Light violence, language, and sexuality. PG-13 Cover designed by Adam Budny
You may also like
Slide 1 of 1
Hecate's Gift (Ari & Soren Book 2) cover

Hecate's Gift (Ari & Soren Book 2)

53 parts Complete

Ari and Soren's adventures continue as Soren struggles with his new vampiric urges and a coven of witches attempts to recruit Ari for their own ends. ***** As dark dreams plague Soren, Ari finds his new abilities difficult to control. Something is awakening within him, and as his power grows, he attracts the attention of a group of witches who call themselves the Hecataeon. They believe Ari is an emanation of the goddess Hecate - a physical manifestation of her power - and they want that power for themselves. With their relationship facing challenges from within, Ari and Soren must find a way to unite their strengths before external forces tear them apart. - NOTE: This book is the sequel to Bound by Blood. - Content Warning: Light violence, language, and sexuality. PG-13 Cover designed by Adam Budny

More details