GUDDAN - AKSHAT MILAAN AU.
nsain25
  • Reads 13,312
  • Votes 629
  • Parts 27
  • Time 1h 50m
  • Reads 13,312
  • Votes 629
  • Parts 27
  • Time 1h 50m
nsain25
Ongoing, First published Jul 21, 2020
Mature
akshanakshatalternativeuniversecuteforeverguddanguddanakshatjindalguddantumsenahopayegahindikalmakanikamaanlakeereinlovenishantsinghmalkanipyaarreemsheikhromancesehbanazimshowyoungestsaaszeetvảj
What happens when Akshat sees Guddan after 4 years in a way he never ever imagined?
.
.
.
AU of serial Guddan Tumse Na Ho Payega...
All Rights Reserved
akshanakshatalternativeuniversecuteforeverguddanguddanakshatjindalguddantumsenahopayegahindikalmakanikamaanlakeereinlovenishantsinghmalkanipyaarreemsheikhromancesehbanazimshowyoungestsaaszeetvảj
Table of contents

27 parts

Sign up to add GUDDAN - AKSHAT MILAAN AU. to your library and receive updates
or
Content Guidelines
You may also like
ISHQ KI JAADU by dreamycore0
15 parts Ongoing
A childhood lost love?! No you can also call it a enemies to lover trope They were seperated when they were young! Why? Cause they were too young to be in love? Maybe! But finally after 4 years of tragic seperation their destiny brings them back together! While they were already searching for eachother their destiny brought them to eachother! It's been only 4 years will they recognise eachother?! They have to too! It's only been 4 years! But weren't they too young then and now have grown up! When they finally meet will they recognise eachother and fall in love again,or not? Dive into the story to know!!
Winning Back My Bondita's Love And Trust ???? by mprvn36
58 parts Ongoing
ANIRUDH reluctantly left Bondita in Krishnanagar and left from there with heavy heart when Thakuma agreed to make Bondita study but not ready to send her to London as she want her house daughter infront of her Even though it's painful for him he still agreed Because Bondita herself agreed with Thakuma reasonable (?) And emotional explanation to stay with them for her mother's and family reputation sake . She wanted to pursue her dreams by staying with her (Das) Family and also agreed to stay away from her sakhababu But 5 years later he is shattered to see and learn about the changed Bondita and became absolutely crazy . He blamed and blamed himself for leaving her in Krishnanagar. It was Another worst decision taken by him for her and believing others . Everyone have lied him cheated him and here Bondita is at fault. What the hell had she done ? How could she do this ? Why did she do this ? Who brainwashed her and made her like this ? Thakuma ? Sumati maa? Society? Did she forget all his teachings? Did she forget him? There are countless questions and he tried to find answers but he didn't get any answer and it made him feel possesive to be Frank obsessive for her. He then took a final and ultimate decision to make things right. He want back his old Bondita. For that he need to bring her back. Make her Bondita Das to Bondita Anirudh Roy Chowdhary again. Let people think whatever they want. Now he won't stop. It's enough. What happened to Bondita? Why was he so mad at the situations and how is he going to make things right? Is it possible to change everything now ? Will Bondita agree with him? Dear friends I got another idea to write a story on our favourite couple Anidita..may not be too long but will be short and sweett and romantic also . I promise you that I will try my level best to meet your expectations After 5 years leap Anirudh Roy Chowdhary - 28 years Bondita Roy Chowdhary - 17 years Remaining characters are same ...
Journey of Khadoos Jindal to Romantic Jindal by shaylini_
52 parts Complete
Guddan and Akshat Jindal (AJ) are married(arranged) for a year now and so are Angad and Nimisha. Guddan is doing her PhD but nobody knows she is Mrs Jindal. Everybody knows her by her maiden name in the university. AJ and Guddan have a cordial Relation not even friendly. They are ok with each other and not developed the bond as such. Guddan is a good daughter in law and everybody in the family love and respect her. Angad and Nimisha have a love marriage.
Confession 💜 ✅ by Mrihika
7 parts Complete Mature
Akshan's cute confession sequence
Changed - ArShi FF (Completed/Under Editing) by Alara0503
23 parts Complete Mature
What if Arnav uses Khushi for his revenge? What if he throws Khushi out after using her? What if he meets her three years later and gets the biggest shock of his life? Will their love bloom again ?
AADAT ~ Kshiteej Kabra by Kshiteejkabra
34 parts Complete
Abhimanyu Mantri, the Most Talented Employee from last 5 years at the most prestigious business enterprise of India - is a charismatic man with the darkest past. (right from : a dream college to a mysterious death) His colleagues and people might get impressed from his personality, but this was never his intention - to impress them. Because from the last half decade - no one was successful to impress - the very-impressive ABHIMANYU MANTRI. Amidst all this, a girl threw herself into his monotonous life - and filled it, with the most enthralling and exquisite moments. Mr. Mantri had hardly started smiling, living his life in the most extravagant way. But little did he know, that this girl - his greatest source of happiness - would lead him again - into his darkest past. So, get ready, to LIVE THIS LIFE. The life of Ayesha Thakur - The girl who committed the biggest crime of her life - The crime of loving - Mr. Abhimanyu Mantri. Cause at the end, You will be compelled to say ~ "Ab mujhe tumhari ek AADAT si ho chuki hain - Ek aisi aadat - joh chahte hue bhi, Main nahi chodh sakti" These lines were spoken by Kavya Mundhra to Abhimanyu Mantri.
MR. AND MRS.JINDAL KI AJAB KAHANI ❤ (Completed) by daydreamer7196
51 parts Complete
"Let's come to the point..Ms. Guddan Gupta..Will you MARRY ME?" He said What the hell did he said.. I looked at him blinking my eyes continuously at him, my jaw almost touching the ground.. His fingers came in contact with my chin and he closed my mouth and I was still looking at him, my eyes wide like saucers.. 'Marry me' his words echoed in my ears.. This man! He has this much audacity to stand here in front of me and ask me to marry and that too MARRY HIM.. I fisted my palms, controlling myself from lashing out at him.. I looked at the papers and then at him.. He was looking at me waiting for me to say something.. I took out my phone and googled something.. "Pen" I asked him rudely.. Now, it's his time to be shocked.. He opened his mouth to say something but nothing came out so he closed his mouth.. "Uncle!!" I called him rudely waving my hand in front of him.. "Pen..Pen maanga humne" I said to him.. He blinked his eyes few times and then gave me a pen taking out from his pocket.. I took the pen and write.. "9876xxxxxx PAGAL AKDU KHADOOS UNCLE" I wrote a number of mental hospital and the rest in big letters making it bold and clear.. I took his hand and just like he kept the papers on my hand..I kept it on his hand but more harshly.. ♡♡♡♡ Our Akshan is back ;) Peep in to join the journey of our Akshan from being poles apart to being one for forever❤ This book has just some things from the show.. It's an akshan story with their cute nok-jhoks and romantic moments and offcourse drama..enjoy! Thank you for giving your time to this story (trust me you will not regret) Do votes and comments..keep smiling :)))) Love ya all ♡♡♡♡♡
Bounded By Innocency (Completed) by magical_sunshine
14 parts Complete Mature
"In a moment of childhood innocence, SHE found herself unwittingly tied to HIM by a simple promise. As the years passed, she harboured a silent love for him, keeping it secret and buried deep within her heart. A life filled with longing and unanswered questions unfolds, revealing a tale of unspoken emotions, cherished memories, and an unyielding hope for a reunion. Will destiny bring them together, or will their story forever remain a wistful echo of the past?" If this most anticipated reunion happens, would everything go well? Having been apart for so long, how will they discover new facets of each other, deepen their connection and build a life together? How would they understand each other, navigate their differences, and venture into the uncharted territory of love? Still, wondering? Peep in to know!!✨ (Previously named as The Exonerated Ecstasy) P.S.- I see Shapoo and Aurrisht as perfect faces for the leads but you are free to imagine anyone. 🥇1st Ranking in #poojasharma on 27th June, 2023
Fidaa - An Akshan Short Stories Collection by desimovieaddict
16 parts Complete
This is a collection of short stories which I have made based on my favourite couple Akshan from the show Guddan Tumse Na Ho Payega. Most of these stories will be my take of some of the stories/scenes that have already happened in the show.
Aesthetic Love by sidneetlover_17
148 parts Complete Mature
Welcome back guys! Back with a new one....😉 What will happen when a flirty guy and a philophobic will fall in into the sea of love...❤️❤️❤️ Will their love story complete?🤔 Read the story to know!😃 Enjoy!🤗
You may also like
Slide 1 of 10
ISHQ KI JAADU cover
Winning Back My Bondita's Love And Trust ???? cover
Journey of Khadoos Jindal to Romantic Jindal cover
Confession 💜 ✅ cover
Changed - ArShi FF (Completed/Under Editing) cover
AADAT ~ Kshiteej Kabra cover
MR. AND MRS.JINDAL KI AJAB KAHANI ❤ (Completed) cover
Bounded By Innocency (Completed) cover
Fidaa - An Akshan Short Stories Collection cover
Aesthetic Love cover

ISHQ KI JAADU

15 parts Ongoing

A childhood lost love?! No you can also call it a enemies to lover trope They were seperated when they were young! Why? Cause they were too young to be in love? Maybe! But finally after 4 years of tragic seperation their destiny brings them back together! While they were already searching for eachother their destiny brought them to eachother! It's been only 4 years will they recognise eachother?! They have to too! It's only been 4 years! But weren't they too young then and now have grown up! When they finally meet will they recognise eachother and fall in love again,or not? Dive into the story to know!!

More details