Love : Not On Earth
skylover136
  • Reads 1,406
  • Votes 239
  • Parts 12
  • Time 1h 30m
  • Reads 1,406
  • Votes 239
  • Parts 12
  • Time 1h 30m
skylover136
Ongoing, First published Jul 24, 2020
apartastronautbetraycantblamegravitydrikshitdrishtifarawaygalaxyintelligenceisroleftalonelovenasaoppositeoppositesrakshitsacrificesciencesmartspacestarssupporttruelove
Can you ever fall in love with someone, who breathes far away, whom you have not seen, not spoken to, not heard of ??? Is it possible??


Drishti, a just 20-year-old girl is attributed to as beauty with brain. Her intelligence is limitless. She has solutions for every complicated equation. She has been undergoing astronautical training for the new mission. This was her professional life, but in her personal life, she has faced the most unfavorable side of her life.

While Rakshit, a 21-year-old fellow, was also undergoing astronautical training for the new mission of NASA. His professional life flawlessly corresponded with his personal life. He has enjoyed the Best face of life drowning in the love of his parents, siblings and has a huge gang of friends, TRUE FRIENDS!  He is no less than Drishti in professional life.

But,

These two hearts, away at far places, can they fall in love? 

Without knowing each other much? 

Without talking with each other?

Were just kept in touch with some e-mail communications that too took quite a longspun time to reach each other? 

Can these departed souls fall in love? 

In space? 

And not on EARTH?

" Waiting is a sign of TRUE LOVE and PATIENCE. Anyone can say I LOVE YOU, but not EVERYONE can WAIT and PROVE it TRUE !!"

" The course of TRUE LOVE, NEVER did RUN SMOOTH !"

Will they ever meet each other?

Will he be with her?

Will she be with him?

" True love never ends! " Will this quote take a true form in their lives? Or they will just keep fantasizing about their partners?


Interested? C'mon then, what has kept you waiting?
All Rights Reserved
apartastronautbetraycantblamegravitydrikshitdrishtifarawaygalaxyintelligenceisroleftalonelovenasaoppositeoppositesrakshitsacrificesciencesmartspacestarssupporttruelove
Table of contents

12 parts

Sign up to add Love : Not On Earth to your library and receive updates
or
#199astronaut
Content Guidelines
You may also like
Whispered Promises ✓ by iyawriteswhat
50 parts Complete
#1st book of promises series. Drishti Khanna is an ambitious girl who fights with every insecurity she has had. Witnessing a struggle full of childhood and teenage, she finally made her dream come true but one thing she never experienced was love. She was so busy with her life struggles that she never wanted anyone to enter her life making it more difficult. She found it much easier to drool over fictional men than on real. But now when she looks back and sees her friends settling up in life, she finds herself alone. According to her, no man is made on earth who can meet her sky-touching standards. Taking a new turn she decides to shift to a new place, where she can experience living alone and independently. Unknown to the fact what the place holds for her. Kabir Deshmukh, born into a political family, has had all the things one can wish for but he didn't want it on a platter. To become something on his own, he tried in the acting field in his teenage. After struggling for years and because of his passion and focus he got the fame and place in the industry he wanted but was it enough? For him yes it was. He got so comfortable in his daily life that his mother insisted too he didn't want to take a step ahead in his life again. The heartbreak he got was also not helping him in the same. But one unknown meeting was going to change his life. Join the journey of Kabir and Drishti, to learn about them and dive into the sea of love..🤍
The Girl With the Red Scarf | ✔️ [DriKshit] by moonlightxtales
49 parts Complete
••• I unfoled the letter, black ink upon white paper, the handwriting strikingly neat. Dearest Drishti, The day I met you, I never knew that one day you would have so much impact upon my life. Before I met you, I was just existing, but now, I am living. Since the day you have stepped foot in my life, Drishti, you have changed me for the better. You give me a reason to smile, to celebrate, to live. In simple words, I cannot imagine my life without you. So, I am sending you a token of love from my side, sincerely hoping that you will accept it. In the glass jar are countless tokens of love for you, Drishti, the girl who makes my life beautiful. From, You have already guessed who ~ Drishti Sharma - twenty one, independant and carefree, lands in Bali to marry the love of her life, Akash. Everything goes fine, that is, until she finds out that Akash is already getting married to a girl named Sweety. Her dreams are shattered and so are her expectations. Torn between love and betrayal, Drishti soon finds her life in jeopardy. ~ Handsome, yet extremely grim in his mid twenties, businessman Rakshit Shergill believes in love as much as he would believe in fairies. To him, love is nothing more than an illusion and a waste of time. But irritated by his mom's constant bickering about his marital status, he decides to go on a trip to Bali, Indonesia to meet Lavanya Kashyap, his supposed bride. But fate has something else stored for them. Rakshit's life changes forever the day he crashes into Drishti Sharma, the girl with the red scarf. ••• Will love bloom among tragedies? {'The Girl With The Red Scarf' is a fanfiction based on the weekly soap 'DivyaDrishti' which aired on Starplus every weekend at 7 pm. It can be currently found on Hotstar} Ranked #1 on #drikshit (as of 4th Sept, 2020 and 25th Sept, 2020) Winner of The Indian Fanfiction Awards 2020
With Mangoes And Chocolates | ✓ by nahiabbatahido
39 parts Complete
An Indian Teenfic | Featured on @AmbassadorsIN Teen-fiction 2024 | | Featured on @RomanceINDIA 's 'Ishq Vishq Pyar Vyar' 2024 | Opposites attract, yeah, we get it. But what about people with similar minds but different morals and priorities? With conflicting beliefs and contrasting perspectives, wasn't it just impossible for them to have a home in this street, called 'love'? And to turn impossible into possible, one has to make a lot of sacrifices. Perhaps, adding a pinch of unfairness would help as well. *********************** Manasvi Mehta knew she was a pathetic mess. With her friends count being zero, her communication skills in negative, her anxiety and impulsiveness reaching its peak, and her sensitive heart leaking tears at the slightest harm to humanity. . .she knew she was not the kind to survive. She though it was a miracle that Bhavuk Thakur developed a liking to her. He seemed to appreciate every inch and depth of her. His compliments made her heart flutter; levitate her off the ground. For the tiniest time period, she thought she wasn't such a burden on Earth after all. She realised he was too good for her. He was better without her; confident and carefree. And for that, she leaves him. But he. . .well, let's just say that he had forgotten how to live without her. [Trending #1 in India as of November 2024]
ʟᴏꜱᴛ ᴡɪᴛʜᴏᴜᴛ yᴏᴜ✔[#1 ɪɴ ꜰʀɪᴇɴᴅꜱꜰᴏʀᴇᴠᴇʀ] by bairiya_
28 parts Complete
_COMPLETED_ ***Warning :- My first book and there's a lot of grammatical mistakes so plz...read at your own risk*** Top Rankings #1 in friendsforever #1 in withoutyou #1 in unrequiredlove #1 in lostwithoutyou #1 in ishankishan #4 in wattpadindianawards "HER" She never believed in LOVE. Why? What's the reason behind her hatred towards LOVE? She knows only one thing LOVE is LUST nothing else. She never felt anything for anyone until that for one person who has changed her life but without even knowing. Before, she didn't believe in LOVE. But After, she was the most popular person in her college to know about LOVE. But can anyone define the term LOVE? She is not perfect not everyone is. She don't know if her words are perfect for someone to understand the term LOVE. But she knows one thing for sure, she will find her LOVE soon... Now she believes in LOVE. "HIM" Hot! Rich brat! But not spoilt. Everyone wants a billionaire as her future husband. But he is not only rich but also Down to Earth person. He can't do justice with any other gurls. His best friend is Jayanti, who LOVES him dearly, unconditionally, he did only one mistake, that he didn't saw the love in her eyes. Neither she was going to separate him from his LOVE nor she was going to live this LIFE without HIM. Can leaving the world will help her from this unconditional LOVE to get rid off? She don't know. She don't want to live but leaving is not the best decision. Can LOVING HIM becomes HER biggest mistake? At last he loves her. She loves someone else. And that someone else loves someone else. Complicated? I know. To know this u just need to add this book on ur library and peek into this story to know the journey of one sided LOVE. To know the alone journey of Jayanti. Do justice with me. Please support me. I m a beginner. Thanks for adding this book into ur Library😊👍🙏. Cover credit :- @_starflies_ and @IndianLegion Started:- 02/09/2018 Completed:- 24/10/2019
WHAT THEY SEE by Mya2tact
42 parts Complete Mature
"I got you something." He told her pulling away, while she watched him curiously until he pulled out a pandora bag. Her eyes widened at the necklace with an infinity symbol in crested with small little diamonds. "How you even afford this kari?" She questioned, unable to take her eyes off of it. "Shit, my savings." He rubbed the back of his head that possessed his starter loc twists. "That was so nice of you, you didn't have too." She smiled softly finally looking at him, "Can you put it on me?" He stood behind her and she moved her hair out of the way as he put it around her neck and clipped it back together. Her hand immediately went to it. "I'm never gone take it off." She promised him turning to face him. "I love you kari." "I love you too, hone. Til Infinity." --- When an unfortunate sequence of events suddenly separates two bestfriends, Dakari and Honesty, with no plausible reason, it's shakes up the world of the two inseparable individuals. With no goodbyes shared, Dakari was left feeling alone and heartbroken by the sudden disappearance of the only person outside of family that he cared for deeply. The outside world declared Dakari mad at the world, and he didn't think he could ever get over the missing void created by her absence. When honesty finds herself back where it all began, she discovers the hard way that Dakari no longer wants anything to do with her. The unexpected reunion rekindles unbearable memories of their deep connection and the painful separation that slowly but surely leads them back to each other. It's up to them to pick up the pieces of their broken friendship as they confront their past and face what's in store for their future, whether it's together or apart. They must decide if their love is strong enough to hurdle over the obstacles sent their way from every angle. Is true love worth fighting for no matter how long it takes? Published; Dec 24th, 2023 Finished; July 3rd, 2024
My Charming Husband by LongingWords
25 parts Ongoing Mature
As I took a seat beside her, I realised that she was awfully quiet. "Is everything fine", I asked her. Naina licked her lips and looked at me. For a few seconds none of us said anything and then finally she said- "Aakash, my family has a second-hand car. I have been earning for quite sometime now but my savings aren't enough for even a bike. We live in a small apartment, which you have seen already, throughout my life I have shared everything...my books, clothes, shoes, cosmetics, even my laptop with my elder sister." I did not understand why Naina was saying all this with a sad expression. To me, everything that concerns her always feels happy and worth being proud of. She continued- "What I am saying Aakash, is that I am nowhere worthy, capable, or even habituated of a life where my husband owns a house with an elevator or where he wishes to buy me a helicopter. We are so different, Aakash. This scares me a lot". Not even for a moment have I ever felt that Naina would be insecure of my living standards. But, I understood where she was coming from. "Naina", I replied, "All this extravagant decorations, this lavish home, my expensive lifestyle,none of this means anything to me. It is a facade I have to maintain for the world. YOU ARE MY HOME". *** Here's the story of Naina Khanna and Aakash Arora. Two people who are from completely different backgrounds, however destiny brings them together and their souls connect. But, when dreams come true unexpectedly, can you keep them safe? Book troupes * Romantic-Comedy * Star-crossed lovers * Unexpected Match * Healing through Love * Personal Growth ⭐1 on #himandher (03.10.24) ⭐1 on #secondleads (25.10.24)
Unforgettable Love by Meena3101
41 parts Complete
" Drishti drishti stop .. stop running you will hurt yourself .. " " nahi rakshit dum hai toh mujhe pakad ke dikhao aao aao " (No rakshit if you have guts than catch me) whole gound was filled with her giggles .. she was running here and their hiding behind the tree..making me catch her we were playing pakdam pakdai .. she was running and I was catching her .. she was 8 at that time and I was 11 .. she love to play the game .. " drishti dekho main thak gaya now stop please .. I am tired .. " "haww the rakshit shergill thak gaya .. hahaha hahahaa" she started laughing on me to tease me and I started running behind her in my original speed as I was just playing with her but now I am going to catch her .. Two childhood Lovers , can't live without each other , when people don't even know to pronounce 'love' they love each other .. they even don't know the meaning of love but still love each other .. they always end up together ... But What will happen when Destiny plays its game and separate them . One forget her whole past and other one is remember their every moment and live for them only .. Both were happy in their lives but both fell incomplete .. Sooooooo ?????????????? Excited ????????
Drikshit Dishi.... Power Of Love And Magic....(Completed) by mnopiuytgddch
49 parts Complete
Warning⚠️: this book is not edited. Has many mistakes! So in this story Divya Drishti are twins with powers separated by Psachini.. after 20 yrs fate made them fall in the same place i.e., in Shergill family... There Drishti met an arrogant CEO Rakshit Shergill nd unfortunately became his P.A. nd coincidentally met her lost sister Divya who was adopted by Shergill family after separated by her twin nd now she is Shikhar Shergill's gf.... Now let's see how both the sisters recognise each other.... nd Love blossom between the arrogant CEO and innocent PA PS : This is my first book... With lot of mistakes ... Plz support me Mature Content!!! © Copyright July2020
𝐔𝐧𝐫𝐞𝐪𝐮𝐢𝐭𝐞𝐝 𝐓𝐨 𝐑𝐞𝐪𝐮𝐢𝐭𝐞𝐝 by tales_by_twins
24 parts Ongoing
When their Unrequited love turns into Requited, everything including the world around them seemed to be faded away and there was only one thing, "them" with true and unconditional "love". The only way to get rid of unrequited love is to "give" it to someone who can "appreciate" it. She in Unrequited love says, "I understand your story, I know your pain, I wanted to be together with you in every rain, I wanted to hold you in my arms and tell you, it's gonna be alright, But I don't know, will it happen one day?" When it turns into Requited he says, "You understand my story, You know my pain, You wanted to be together with me in every rain, You wanted to hold my arms and tell me, it's gonna be alright, And see, all it happens today". {Here, He and she refers to Main leads} Discover the universe of Unrequited To Requited love..... Raghav Grewal × Janki Tripathi => Professor × Student => She fell first, Both fell harder => Grumpy × Sunshine Shivansh Singhania × Gauri Tripathi => C.E.O × P.A. => Office romance => Grumpy × Sunshine Madhav Grewal × Radhika Tripathi => Classmates => He fell first, both fell harder => High school romance => Brother's best friend Manav Tripathi × Ayushi Grewal => Classmates => He fell first, Both fell harder => High school Romance => Brother's best friend 😅Ab yahan tak aa hi gaye ho toh Book padh kar jana 🔪👺 Started: 13th July 2024 End:
Just Friends by its_sanjh
63 parts Complete
• She was broken piece of glass while he had the glue that could mend it together. • Kiara is a girl that wanted to fall in love. Meet her soulmate but unfortunately started having feelings for her friend, Dhruv. The person whom she can't reach. She knew she won't ever be offered a happy ending in her journey of unrequited love. Dhruv was a guy that was full of life. Encountered a situation where he was asked by his parents whether he would like to marry his friend Aditi? He didn't think anything wrong with it. How could it be? When your life partner ends up being your friend for years. Until he discovered each step taken towards Aditi was pulling him away from Kiara. Aditi has a dream of her wedding. A dream that she had seen in childhood. She is all set to make it a reality, but things aren't that easy. She has constantly fought with not only others but with herself as well. Her workaholic nature as well as fear of her past keep knocking on her door at frequent intervals. Harshad is an attractive guy, a charmer. His personality had always attracted ladies, but a girl that has the least interest in him pulled his attention. A guy that believed in dating and flirting suddenly wants to win Kiara's heart. So many feelings are involved! So many hearts are on the verge of breaking. Who will gain and who will lose? Text Copywriter © Sanjh™ 2022
You may also like
Slide 1 of 10
Whispered Promises ✓ cover
The Girl With the Red Scarf | ✔️ [DriKshit] cover
With Mangoes And Chocolates | ✓ cover
ʟᴏꜱᴛ ᴡɪᴛʜᴏᴜᴛ yᴏᴜ✔[#1 ɪɴ ꜰʀɪᴇɴᴅꜱꜰᴏʀᴇᴠᴇʀ] cover
WHAT THEY SEE cover
My Charming Husband cover
Unforgettable Love cover
Drikshit Dishi.... Power Of Love And Magic....(Completed) cover
𝐔𝐧𝐫𝐞𝐪𝐮𝐢𝐭𝐞𝐝 𝐓𝐨 𝐑𝐞𝐪𝐮𝐢𝐭𝐞𝐝 cover
Just Friends cover

Whispered Promises ✓

50 parts Complete

#1st book of promises series. Drishti Khanna is an ambitious girl who fights with every insecurity she has had. Witnessing a struggle full of childhood and teenage, she finally made her dream come true but one thing she never experienced was love. She was so busy with her life struggles that she never wanted anyone to enter her life making it more difficult. She found it much easier to drool over fictional men than on real. But now when she looks back and sees her friends settling up in life, she finds herself alone. According to her, no man is made on earth who can meet her sky-touching standards. Taking a new turn she decides to shift to a new place, where she can experience living alone and independently. Unknown to the fact what the place holds for her. Kabir Deshmukh, born into a political family, has had all the things one can wish for but he didn't want it on a platter. To become something on his own, he tried in the acting field in his teenage. After struggling for years and because of his passion and focus he got the fame and place in the industry he wanted but was it enough? For him yes it was. He got so comfortable in his daily life that his mother insisted too he didn't want to take a step ahead in his life again. The heartbreak he got was also not helping him in the same. But one unknown meeting was going to change his life. Join the journey of Kabir and Drishti, to learn about them and dive into the sea of love..🤍

More details