The Fate of Fallen Angels
DreamsOfABibliophile
  • Reads 23
  • Votes 1
  • Parts 4
  • Time 43m
  • Reads 23
  • Votes 1
  • Parts 4
  • Time 43m
DreamsOfABibliophile
Ongoing, First published Aug 05, 2020
abuseadventurecivilwarfantasyhighfantasymagicwar
Three cousins, all royalty, fighting against everything they've ever known. 
For decades, a civil war has plagued what used to be peaceful North America. 
And Alyss Urelia finds herself in the middle of it all.
Her heart belongs on both sides. 
Freedom is complicated. 
What will they sacrifice?
How hard are they willing to fight for it?
All Rights Reserved
abuseadventurecivilwarfantasyhighfantasymagicwar
Table of contents

4 parts

Sign up to add The Fate of Fallen Angels to your library and receive updates
or
#859highfantasy
Content Guidelines
You may also like
Enmity by MathiasDos
6 parts Complete
A continent on the brink of war, families on the verge of separation, countless men and women unknowingly on the edge of death's doorstep... Frelia had seen peace for the past four consecutive decades, since the end of the continent's largest war. However peace was always bound to fail. A regime change has fallen upon the Imperial Senate, the governing force of the largest empire in Frelia: The Imperial Empire. With a new government and a new desire for war, the empire launches an assault against its former enemies. Threatened by the destruction of his home, a young elf is forced to help his former guild in hopes of saving what he loves. He will have to face unmoral decisions, unlikely of enemies and ancient secrets. Will he be able to save what he loves and restore peace, or simply perish like a pawn in a game of chess? **NOTE** Cover is only for temporary use.
A Servant Lost (Alys Book #1) by BriaVangau
36 parts Complete
Alys is an unwanted servant trying to live by any means possible in a land that is threatened by wars and conflict. With no memory of her childhood or early youth, Alys has nothing to her name and no hope for the future unless she agrees to marry; a thing she has no desire to do. But then she meets Prince Dastrehan, who offers her a deal that may be a key to a better life. Can Alys trust him? Is it at all possible that a servant girl with an unknown past could turn her life towards a brighter future? *Cover photo purchased off of Shutterstock* Rankings: #1 in Medieval, May 2022 #2 in Princess, Oct 6th, 2022 #5 in King, March 21st, 2022 40k March 22, 2022 50k June 30, 2022 60k Oct 3, 2022 70k Feb 20, 2022 80k Sept 10, 2023
Hall of Games [ REWRITE ] | The Varya Chronicles #1 by seventhstar
42 parts Complete
MISTBORN x GAME OF THRONES *Wattpad YA profile Featured story* If Cadence had said no to a blood spirit, the noble family she worked for would still be alive. Her brother wouldn't be conscripted into the Hall of Games. She wouldn't have to follow him and be a soldier for the rest of her life. Her Papa would still have his head. A close brush with death awakens her necromancy abilities, and she becomes hell-bent on resurrecting her father. However, necromancy is forbidden, and if her secret is exposed, the Hall of Games will execute her. As her new powers demand more than her body can ever give, it will ultimately push her humanity to its limits-if saving her father doesn't destroy her first. Highest ranking: #91 in Fantasy [11/7/17] Book trailer by @ice-breaker
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
Chronicles of Ounivat - A World Beneath the Earth by MidwaterOnFire
4 parts Ongoing Mature
*** This is a work in progress. Details are subject to change as editing and writing continue. Regular updates are not guaranteed - but polite encouragement may help with writing motivation. *** *** Cover by Leighabear0625 from years ago, also may be subject to change. *** What if, one day, you woke up in a different world? What if, by chance, that world was about to explode into civil war? For Emry McAdams, that is exactly what happened. Thrown into the battling blue underground realm of Ounivat, Emry must find a way back home. With only the whispers in the cracks of the castle labyrinth and the begrudging aid of a terrifying general, will they even make it to the surface alive, especially considering they might have more to do with their world than any of them know?
The King's Gilded Warrior || Wattys 2023 by niahouston
21 parts Complete Mature
Book 1 in the 'Royal Warrior' Series A world on the brink of destruction, one warrior must find the strength to face her greatest challenge yet. When Lyra, a skilled fighter, is suddenly transported to a magical realm filled with danger and wonder, she knows that she must find a way back home before it's too late. But the path ahead is treacherous, and Lyra must overcome new hardships and obstacles at every turn. In this epic tale of romance, adventure, and fantasy, Lyra discovers that the true strength she seeks comes not from her sword, but from within herself. Filled with magic, danger, and the healing power of self-discovery.
Echoes of the lost Song by ArcaneScribe_1165
11 parts Ongoing
In the northernmost kingdom of Elarion, where emerald forests stretch endlessly and magic pulses through the land, an ancient fae queen and her powerful siblings rule a realm bound by nature's forces. But outside their mystical borders, the human king Aldred of Menoria, driven by ambition and the hunger for magic, is watching. His heart is cold, his soldiers relentless, and his son, Prince Dorian, leads a campaign to claim the one thing that eludes their kingdom-control over Elarion's untamed power. When King Aldred's armies breach the sacred fae lands, an unthinkable war ignites-a conflict the fae call the War of Echoes. As human iron clashes with elemental magic, Queen Miradel of Elarion must rally her siblings, each wielding powers tied to the earth, wind, and beasts, to defend their ancient home. But the humans bring fire and steel, and at their head, Prince Dorian, a warrior as calculating as he is fierce. With the fate of their realms hanging by a thread, alliances will be tested, loyalties shattered, and both sides will learn that the echoes of war reach far beyond the battlefield. Magic, honor, and the survival of entire kingdoms collide in an epic battle for dominance-and in this war, even the victors will be haunted by the cost.
The Shadow's Star by Llouisewrites
25 parts Complete Mature
18+ Loosely based on Romeo and Juliet set in a magical fae world. Two powerful families have ruled over the the dark and light fae for thousands of years. A story passed down from the old gods has them believe that the dark and light fae must remain separated in order to protect their magic. Only during the eclipse one day a year are the fae permitted to cross into each other's realms. During the eclipse Aurora a rebellious high born fae, secretly attends a masked party where she meets a handsome dark stranger called Azra. Will they bring the light and dark fae together to fight a common enemy? Are they fated to destroy the world or to save it?? Includes- an enemies-to-lovers story: a strong female lead, a handsome male counterpart, betrayal, heartbreak, lots of unexpected twists, epic ending, action packed, and plenty of smut. 18+ ONLY Trigger warnings!: adult language, graphic violence, scenes of a sexual nature, abuse. (Started August 2021) All rights reserved.
Of Winds And Quakes by Lizsby
67 parts Complete
Bruised. Battered. Betrothed. King Tus III is anxious to find a bride for his son and heir - Prince Kyan. But the defiant Prince insist on having a wife "who's thoughts move the Earth." The King and Queen search the Kingdom and yet do not find such a girl, so they invade other Kingdoms and conquer them in search of a befitting bride for their son. Alysia is the first child of a peasant family in the Kintil Kingdom. All her life, she has been suppressing herself because of the strange powers she possesses. Her world crumbles when her Kingdom is raided and her family is separated. She is sold as a slave to a goldsmith but when she plans an escape which she uses her strange abilities, she is captured and sent to the King to be the wife of the Prince. Can Alysia escape from a forced marriage and re-unite with the people she loves? Are her strange abilities a blessing or a curse? Copyright©2018 All Rights Reserved Written in various POVs Drafted:July 13 & August 3 2018 Started: 5 August 2018 Finished: September 12 2018 🏆🎖️1st Place in Fantasy category of The Tip Top Awards 🏆🎖️1st Place in Fantasy of the Royal Awards 🏆🎖️ Best Plot in the Dark Magic Awards #9 royalty - 16 March 2021 #30 bride - 25 Dec 2020 #27 elements - 29 Dec 2020 #11 contractmarriage - 16 March 2021 #8 betrothed - 16 March 2021 #10 historicalfiction - 22 Dec 2020 #1 Africa - 30 Sept 2020 #1 Historicalromance - 20 Dec 2020 #23 African - 22 Dec 2020 The Way Of The Wind|Of Winds And Quakes
You may also like
Slide 1 of 9
Enmity cover
A Servant Lost (Alys Book #1) cover
Hall of Games [ REWRITE ] | The Varya Chronicles #1 cover
The Bane of the Empire cover
Chronicles of Ounivat - A World Beneath the Earth cover
The King's Gilded Warrior || Wattys 2023 cover
Echoes of the lost Song cover
The Shadow's Star cover
Of Winds And Quakes cover

Enmity

6 parts Complete

A continent on the brink of war, families on the verge of separation, countless men and women unknowingly on the edge of death's doorstep... Frelia had seen peace for the past four consecutive decades, since the end of the continent's largest war. However peace was always bound to fail. A regime change has fallen upon the Imperial Senate, the governing force of the largest empire in Frelia: The Imperial Empire. With a new government and a new desire for war, the empire launches an assault against its former enemies. Threatened by the destruction of his home, a young elf is forced to help his former guild in hopes of saving what he loves. He will have to face unmoral decisions, unlikely of enemies and ancient secrets. Will he be able to save what he loves and restore peace, or simply perish like a pawn in a game of chess? **NOTE** Cover is only for temporary use.

More details