Story cover for Ravenhel by eaq_17
Ravenhel
eaq_17
  • WpView
    Membaca 290
  • WpVote
    Vote 16
  • WpPart
    Bab 11
  • WpHistory
    Durasi 1h 21m
  • WpView
    Membaca 290
  • WpVote
    Vote 16
  • WpPart
    Bab 11
  • WpHistory
    Durasi 1h 21m
eaq_17
Bersambung, Awal publikasi Agt 17, 2020
adventurecomingofageevilkingfaeriefantasyfriendshipgiftskingdomslovemagicplottwistpowersqueenromancewolves
When old terrors invade Freddie's life in the Human Fold, she is forced to return home to the faerie lands of Eses. 
But home is where the terrors are. 

Freddie must take up her old name, step into her role as a leader, and conquer her demons before it's too late. 

But a deadly enemy stirs, and time is running out.
Seluruh Hak Cipta Dilindungi Undang-Undang
adventurecomingofageevilkingfaeriefantasyfriendshipgiftskingdomslovemagicplottwistpowersqueenromancewolves
Daftar isi

11 bab

Daftar untuk menambahkan Ravenhel ke perpustakaan kamu dan menerima pembaruan
atau
#64evilking
Panduan Muatan
anda mungkin juga menyukai
Children of Sun and Peace oleh manon707
99 bab Lengkap Dewasa
Over two years have passed since Freya entered the Midnight City and alongside her new family of misfits joined its citizens. But life of a soldier quickly whisked her far beyond the city's borders and those she loves the most. Now the time has come to return to the Winterlands capital and help protect the city during the Royal Trials. At the same time, the merciless waters of the Northern seas keep bringing unknown visitors to the Winterlands' shores. In the mighty shadow of an arena where trials take place, stuck in a web of secrets as well as carefully crafted lies of her own making, Freya must face yet another choice being taken from her, another change to the life she carved in blood for herself. And all that while the long forgotten past conveniently comes knocking... Disclaimer: This is a second book in a trilogy. In order to understand the story, please make sure to read 'Children of Night and Snow' first.
Moonfall | Book Two oleh True-North
34 bab Lengkap
As the moon hung high, casting its light upon them all, No sooner than its rise, did that moon and its light fall. *** For the past year, eighteen-year old spare heir and werewolf Michael has lived in the shadow of loss. Unable to shake the guilt of not saving his older brother, grief haunts him like a second shadow, and to make things worse, a recurring dream of a mysterious girl won't let him go. When that dream leads him to the once forbidden Woodlands, Michael makes a chilling discovery: a living Fae. Not only should her presence be impossible, as her people no longer inhabited this world, her existence is dangerous. For her. For him. For his mother, whose role in helping the Fae escape the almost war a year ago would be seen as treason by his pack and his father, the ruthless Alpha. To protect his mother, Michael must smuggle the fairy to the new Fae world before anyone discovers her. To do that, he'll need the help of the Witches-his best friend Zanna, in particular-but tensions between the Wolves and Witches are high as both are fighting to claim the abandoned Woodlands. And if he cannot ensure neither side's claims are successful, the fairy will be exposed along with his mother's secret. But protecting the fairy comes at a price. Michael wants to hate her, but finds himself drawn to her in ways that threaten his mission and his heart. And with a forced betrothal looming over him, falling for the fairy is absolutely not an option. Torn between loyalty and truth, duty and heart, Michael must decide who he is: the Alpha's son, the grieving brother, his mother's protector, or something else entirely. Because the Woodlands are stirring again, and Michael's choice could bring war or redemption.
Myth Breaker oleh LauraTWrites
38 bab Lengkap
𝓕𝓪𝓶𝓲𝓵𝔂 𝓓𝓸𝓮𝓼𝓷'𝓽 𝓔𝓷𝓭 𝓲𝓷 𝓑𝓵𝓸𝓸𝓭 Morgan is sent to live with her grandmother at a college in the middle of nowhere. Forced from the sun and bustling city to a cold and rainy forest. There she finds out that her world is a lot bigger than she expected, that humans are surrounded every day by vampires, werewolves, and witches, more than that she might actually be one herself. Now she has to learn how to control her powers and how to live and interact with other supernatural creatures. Like the werewolves that won't leave her alone - not that she really wants them to - and the vampire tutor that makes her heart pound loudly in her chest whenever she sees him. Not only that but outside of the school, something is brewing other supernatural creatures hate seeing the interactions of the school. For centuries vampires and werewolves have hated each other but here they are learning and working together. A war is coming to rip them apart and Morgan might end up caught in the middle of it because of her feelings for both the werewolves and the vampire. Can she learn to control her powers before the war comes and help protect the school and the people that mean so much to her or will she be too late and lose everyone she cares about just as she is starting to learn to trust and love again? 𝑯𝒊𝒈𝒉𝒆𝒔𝒕 𝑹𝒂𝒏𝒌𝒊𝒏𝒈𝒔 #2 𝘪𝘯 𝘙𝘰𝘮𝘢𝘯𝘤𝘦 #1 𝘪𝘯 𝘙𝘦𝘷𝘦𝘳𝘴𝘦 𝘏𝘢𝘳𝘦𝘮 𝑹𝒆𝒂𝒅𝒊𝒏𝒈 𝑳𝒊𝒔𝒕 𝑪𝒆𝒓𝒕𝒊𝒇𝒊𝒆𝒅 @𝘞𝘢𝘵𝘵𝘱𝘢𝘥𝘜𝘳𝘣𝘢𝘯𝘍𝘢𝘯𝘵𝘢𝘴𝘺 - 𝘊𝘪𝘵𝘪𝘧𝘪𝘦𝘥 𝘓𝘰𝘷𝘦 𝘗𝘰𝘵𝘪𝘰𝘯𝘴
She's The Enemy (GxG) oleh JustFeelsRight
58 bab Lengkap
All Emelie has ever been told is never to cross the border that separates the Fae and human lands, especially after her mother was murdered during a Faerie attack. However, when she finds an enchanting Fae Princess injured by the lake, this girl becomes the allure that keeps pulling her back to a place she knows that she is forbidden to go. How can this girl be the enemy they've been scared of all this time? . "You told me she didn't want to be scared anymore, but that can't be the only reason... can it?" . "Maybe... she met a girl and she couldn't run away. Because the allure of her eyes and her touch was too strong to fight. And maybe part of her didn't want to fight it. Maybe she wanted her life to be more than just a slideshow of events..." . "So that's why she keeps coming back..." . Contains mild swearing Milestones! 20k- 26/08/2020
Lost Soul oleh dandanthewriterman
45 bab Lengkap Dewasa
Seemingly fearless leader, Raven Black, is thrust out of the only home she's ever known, into a world long thought dead, by invaders from another world who are led by a man her mother seems to have a past with. She'll do anything to protect her team even while struggling through the invaders' trials, her mother's betrayal, and uncovering her own dark past.
The Vampire and the Orphan oleh HeidiCarroll
13 bab Bersambung Dewasa
After several centuries of serving as a guard to a coven, Nathanial Hart, a lone vampire, is finally able to live out his days on his own terms, secluded and unbothered. After he fulfills this one last promise to the one and only friend he ever had in his long life. For eighteen years , Olette Sky, a spirited, young girl has been locked away in an orphanage, but she has finally been set free and sent off. She's told to find the path of an unknown man, the cryptic advice of her den mother. .. and so the young mysterious girl, called Lettie, ventures out alone, finding herself in a heap of trouble just as her path collides with Nathanial's. Danger unlike anything Nathanial has ever known lurks around this odd girl like a magnet, and it seems he is the one tasked to keep her safe. But why? What is so special about this orphan girl?
The Bane of the Empire oleh AnnyVirdi
41 bab Lengkap
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
Seasons of Ferne, Summer's Passion oleh mike_yeaton
40 bab Lengkap
Abandoned on the steps of a church as an infant, Evelyn Ferne finally feels as though her life is coming together. At long last she has the parents she's always longed for, as well as her first taste of real romance and love. But try as she might her life has never been normal. Abilities to which she has little control and even less understanding have always threatened to derail the life Evelyn worked so hard to build. Abilities that are steadily growing in strength and diversity. And now Evelyn's tenuous hold on life has been threatened further still. A friend, once thought imaginary, has made a very sudden, very real re-appearance, bringing to life secrets and dangers from a past and a world Evelyn never knew existed. A world that wants nothing more than to tear everything she loves apart. Will Evelyn be able to hold onto the life she's always wanted and protect those she loves, or will the unknown darkness from her hidden past claim her for its own.
John - The Young Wizard oleh JohnDiaz1
22 bab Lengkap
story of a boy's journey to his untold life of wizardry. story about friends, family and enemy. John was a prince of their kingdom who were hidden in a mortal world. To save him from everyone who wants to rule the land of wizards and witches. He was the last kin of the good wizards. The war of good and bad were never ended until one prophecy told everyone that there will be one boy that will live and will stop Lord Vindor. When they know about this, Eric one of the good wizard made a plan on the night queen Amanda give birth to his son he exchange the baby with another boy. And he bought the baby to the mortal world. To Isaac and Ella other good witch and wizard who choose to live in peace and live simple life in mortal world. Isaac and ella accept the baby knowing that this will save the race of good witches and wizards. John will grow and learn about his true life, and will meet young people like him with different abilities same with him. And together they will fight Lord vindor and save the humanity.
anda mungkin juga menyukai
Slide 1 of 9
Children of Sun and Peace cover
Moonfall | Book Two cover
Myth Breaker cover
She's The Enemy (GxG) cover
Lost Soul cover
The Vampire and the Orphan cover
The Bane of the Empire cover
Seasons of Ferne, Summer's Passion cover
John - The Young Wizard cover

Children of Sun and Peace

99 bab Lengkap Dewasa

Over two years have passed since Freya entered the Midnight City and alongside her new family of misfits joined its citizens. But life of a soldier quickly whisked her far beyond the city's borders and those she loves the most. Now the time has come to return to the Winterlands capital and help protect the city during the Royal Trials. At the same time, the merciless waters of the Northern seas keep bringing unknown visitors to the Winterlands' shores. In the mighty shadow of an arena where trials take place, stuck in a web of secrets as well as carefully crafted lies of her own making, Freya must face yet another choice being taken from her, another change to the life she carved in blood for herself. And all that while the long forgotten past conveniently comes knocking... Disclaimer: This is a second book in a trilogy. In order to understand the story, please make sure to read 'Children of Night and Snow' first.

Detail lengkap