Disasters Related to Life
the_nero0
  • Reads 73
  • Votes 1
  • Parts 7
  • Time 1h 15m
  • Reads 73
  • Votes 1
  • Parts 7
  • Time 1h 15m
the_nero0
Ongoing, First published Aug 23, 2020
actionadventurebetrayaldragonsdwarveselvesfamilyfantasyfantasyadventuregodshighfantasylgbtlgbtfantasylgbtfictionmagicnewwriternymphromanceroyalsroyaltysecretidentitysecretswitch
A mysterous man is sent on a jounrney. He finds trouble, family, injustice, and loyality along the way. He relearns things has has forgotten and learns new things. 

What would they discover as they continue their journey to the Elven Realm of Enilfry
All Rights Reserved
actionadventurebetrayaldragonsdwarveselvesfamilyfantasyfantasyadventuregodshighfantasylgbtlgbtfantasylgbtfictionmagicnewwriternymphromanceroyalsroyaltysecretidentitysecretswitch
Table of contents

7 parts

Sign up to add Disasters Related to Life to your library and receive updates
or
#524dwarves
Content Guidelines
You may also like
The Potion of Life by driesmeesseman
28 parts Ongoing
In the realm of shadows, the enigmatic drows have endured for over ten millennia, their existence shrouded in the veiled mysteries of a world unseen. Yet, there was a time when their presence graced the vibrant planet of Mysterix, long before the cloak of darkness became their domain. Now, an insatiable yearning stirs within them, an unquenchable desire to rekindle the forgotten ties to their once-familiar home. Hope gleams on the horizon, kindled by the ingenuity of Vilijn, a visionary drow whose relentless pursuit of knowledge has uncovered a tantalizing secret. He discovered the location of three elusive ingredients crucial to the creation of the fabled Potion of Life. As Vilijn's revelations awaken a glimmer of possibility, the drows stand at the precipice of destiny.
Caged Birds Will Fly by EarlGrey_Books
22 parts Complete Mature
The days that I wake up and look into my brother's eyes are long gone, now I only see the sword pointing at my neck. One wrong move and I'll never escape the claws that surround this country. A new life, new family, and a new purpose: to return to my home, with Eli. My life will go down in history, but before it does I'll tell you a story: My Story. I remember everything so clearly: the fire, running through the forest, the wolves,... and most importantly, the fall into darkness. In the land of Elevrly lies deceit, romance, trust, revival, and secrets unkept. Who is your enemy? Who is your ally? I am about to find out. Everything. ----------------- Helen only had her brother and her father, after her mother passed away. But, the neighboring country, Trenton caused them to go into hiding. One night a fire breaks out and Helen has to fend for her and her brother Eli. After battling mother nature, they both end up separated in a land of magic called Elevrly. Now they must find each other through a maze of lies and deceit and uncover the mysteries untold.
Erivale: The Lost Princess by KroseWriter
53 parts Complete
Amberleigh had been recklessly traveling between realms for years (accidentally, of course) unsure of how or why she continually found herself in a world called Erivale. Stuck in a not so great situation in the human realm, she escapes by literally falling into Erivale once again - although this time is different. A mysterious man traveling with a pack of wolves snatches her from the edge of death and claims to know her history. He also wants the bounty on her head. Leave it to the cold-blooded stranger to not so subtly break the news - Amberleigh was an Elf. Of course, it couldn't just stop there; she was an Elven princess. Cue adventures, sword battles, etiquette lessons, and magic. Amberleigh will need all the help she can get to make it through. The world of Erivale isn't as magical as it seems, and a mystery is unfolding - one that threatens Amberleigh's life and the freedoms of those around her. The Lost Princess is returning to Erivale, and no one, not even she, is ready for what is to come. Currently being edited. Damn Fine Writing Contest Grand Winner 2/13/2020 The Warrior Awards Third Place 3/28/2020 The Sparkle Awards First Place 5/26/2020 Rated ⭐️⭐️⭐️⭐️⭐️ by the Mystical Awards 6/3/2020
Born in the Flame by greenbeanslinger
35 parts Complete Mature
Elwin is a dusk elf who happens to be a dwarven blade-smith in a world ruled by the gods and their children. She works under her legendary blade-smithing father in their forge. Adopted as a newborn, she had never known what it had meant to be elven. She had never cared to know. All she knew was that the dawn elves had oppressed the dwarves a century before she was born, and the rest was unnecessary knowledge. Making blades and wielding fire magic was what mattered to her in the end. On a day that started like any other, a strange traveler appears with a strange request. Elwin is thrown into traveling outside her dwarven city and into the world that she had been subconsciously hiding from and embark on a quest to kill a god and save the world from a dark age of bloodshed.
Bound By Starlight ~ Thranduil x Reader by Horizon513
14 parts Ongoing Mature
Hidden away in an ancient tower, Y/N has lived her entire life in solitude, her only companion a sassy little gecko named Lómin. Bound by duty and the whispered warnings of her guardian, she has never stepped beyond the walls that confine her. Her gift, the power to heal wounds and reverse decay, flows through the long silver strands of her hair, but it comes at a cost. To use it, she must recite an ancient Elven prayer, a song of starlight that could make her either a savior or a target. The outside world is dangerous. She has been told this all her life. Kings would seek to control her. Thieves would try to take what is not theirs. And once her secret is known, she will never be free. But when fate sends an unexpected visitor to her tower, Y/N must make a choice: remain a prisoner of safety or risk everything for a chance at freedom...perhaps, even love. ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ⚠️ Warnings ⚠️ • Violent Scenes • Graphic Descriptions • Sexual Themes • Age Gap • Strong/ Offensive Language ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Status: Ongoing • Started: 07/03/25 • Finished: ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Disclaimer • I don't own TLOTR/The Hobbit or its characters. • I do own Y/n + some extra added characters
Agony • Concealed Memories | | Thranduil by IamMerakii
19 parts Complete
When a darkness spreads across Mirkwood, a mighty elven kingdom is robbed from its bliss. A once vibrant people hides behind the walls of their kingdom and the forest grew into a bleak and uneasy place. The other realms suspected Thranduil of being embittered by Saurons return, the growing darkening of his kingdom and the domination of Shelob's children beneath the canopy of his forest. Nothing could've been further from the truth. There was another reason why Thranduil grew bitter and isolated. A reason no one dared to speak about. And as people stopped talking about it, memories faded, got twisted and turned, until dozens of versions left people confused. They had forgotten Thranduils love for life, for his kingdom. The memories fell into extinction and people no longer remembered. Except for Thranduil. This is the story of Thranduil and the memories he hid in the depths of his soul. A pain that has wrenched his heart. A pain that can best be described as; 'agony.'
The Storm We Start || Book One by ShyGuySamurai
36 parts Complete
|| Book One of the Dragonkind Duology || 𝙄𝙩 𝙬𝙖𝙨𝙣'𝙩 𝙖 𝙢𝙖𝙩𝙩𝙚𝙧 𝙤𝙛 𝙞𝙛 𝙗𝙡𝙤𝙤𝙙 𝙬𝙤𝙪𝙡𝙙 𝙗𝙚 𝙨𝙥𝙞𝙡𝙩; 𝙞𝙩 𝙬𝙖𝙨 𝙬𝙝𝙚𝙣. For years, dragonkind and humankind had been at war, alternating between short-lived truces and all out warfare. In this age, however, humankind had subdued the proud dragonkind and turned them into slaves. Brands seared into their arms with the mark of a weeping dragon; the symbol of their defeat. Darin vehemently hated the mistreatment of the dragonkind, and when a branded runaway boy crossed his path, he made him his apprentice to protect him. Something had to be done. But in a strange turn of events, Darin found himself the leader of a peculiar band of travelers: His new apprentice, a brooding warrior, and an elven healer. Although he rarely traveled with others, he began to enjoy it as a long-term arrangement as days turned into weeks. Yet Amaredeia was still healing its war-ravaged wounds, and the cries of rebellion and anguish rose again. Could he really continue denying the calls of his apprentice's people? 𝙈𝙖𝙮 𝙊𝙧𝙙𝙚𝙥𝙝𝙪𝙨 𝙨𝙖𝙫𝙚 𝙩𝙝𝙚𝙢 𝙖𝙡𝙡. Blurb modified by @aleshawrites_ || Wattys2021 Shortlister and Ambys2022 Winner || || Featured on @Fantasy @highfantasy @WattpadFriendsandFamily @Watt-Dragons|| Written for the Open Novella Contest 2021, but it turned into a novel instead of a novella XD || A round one Ambassador's Pick || Milestones: ✔️2,000 words ✔️8,000 words ✔️20,000 words - Reached on 2/27/21 Total word count: 80,522 Started: Feb. 5, 2021 Completed: Sep. 7, 2021
Priestess by AmberArgyle
43 parts Complete
For decades, Ara's kingdom has suffered from a bloody invasion. Generations of gifted men and women have been murdered by assassins in order to cripple their armies. One life, one village at a time, her kingdom is losing. Their only hope lies in an ancient prophecy of a priestess who will rise up and drive out the invaders. When the assassins come to believe that priestess is Ara, her only hope of surviving lies the hands of a man with a mysterious past and a dubious gift of his own. Ara has much to learn, and fast. Because unless she can stay ahead of the Assassins, she may not live long enough to develop into the priestess fate is forcing her to be. www.amberargyle.com
The Chase by lovelycrowsong
48 parts Complete Mature
Evie is haunted by her past, and so tangled up with her best friend and room mate she isn't even sure she remembers how to be an independent person anymore. This Roadtrip was going to be their last big hurrah as room mates. One last wild long party together before finally trying to grow up. On one of the last nights of their road trip, Evie runs into someone who is more than willing to follow her anywhere, someone who knows he was made to love her. Too bad her best friend is determined to sabotage him anyway she can. Now complete :)
You may also like
Slide 1 of 9
The Potion of Life cover
Caged Birds Will Fly cover
Erivale: The Lost Princess cover
Born in the Flame cover
Bound By Starlight ~ Thranduil x Reader cover
Agony • Concealed Memories | | Thranduil cover
The Storm We Start || Book One cover
Priestess cover
The Chase cover

The Potion of Life

28 parts Ongoing

In the realm of shadows, the enigmatic drows have endured for over ten millennia, their existence shrouded in the veiled mysteries of a world unseen. Yet, there was a time when their presence graced the vibrant planet of Mysterix, long before the cloak of darkness became their domain. Now, an insatiable yearning stirs within them, an unquenchable desire to rekindle the forgotten ties to their once-familiar home. Hope gleams on the horizon, kindled by the ingenuity of Vilijn, a visionary drow whose relentless pursuit of knowledge has uncovered a tantalizing secret. He discovered the location of three elusive ingredients crucial to the creation of the fabled Potion of Life. As Vilijn's revelations awaken a glimmer of possibility, the drows stand at the precipice of destiny.

More details