Isekai 404: Hero Not Found
itsyourstruly02
  • Reads 103
  • Votes 10
  • Parts 4
  • Time 19m
  • Reads 103
  • Votes 10
  • Parts 4
  • Time 19m
itsyourstruly02
Ongoing, First published Sep 11, 2020
Mature
actionadventureangelsanimecomedydwarveselvesfantasyfantasycreaturesfightingfunnyfuntoreadgamegoddessharemidontknowisekailaughlaughoutloudmagicreincarnatedreincarnation
Everything goes right for Sasaki Shingaru when he gets hit by a car... on purpose. A magical Goddess grants him his one wish, a never ending slice of pizza, and sends him on his way to the magical world of Arcalude. 

Where are all the women at? I had been ripped off... it was only men as far as the eye could see. That damned goddess! 

Join Sasaki as he stumbles his way through numerous comedic adventures in an attempt to become a "overpowered MC with a harem!"

COVER BY @-SOPTORO
All Rights Reserved
actionadventureangelsanimecomedydwarveselvesfantasyfantasycreaturesfightingfunnyfuntoreadgamegoddessharemidontknowisekailaughlaughoutloudmagicreincarnatedreincarnation
Table of contents

4 parts

Sign up to add Isekai 404: Hero Not Found to your library and receive updates
or
Content Guidelines
You may also like
The little gluttonous child needs to eat by Alkaysare
76 parts Ongoing
Yao Yao was born as a little glutton, her appetite rivaling half a mountain. One day, the old Taoist who adopted her passed away in meditation. At just three and a half years old, Yao Yao had no choice but to pack her small bag and head down the mountain to find her senior master. By chance, she ended up saving a wealthy tycoon from a car accident and became the adopted daughter of the prestigious Gu family. At first, everyone in the Gu family opposed the idea. The Gu family matriarch tapped her cane and said, "Raising someone else's child? Careful not to end up with an ingrate!" The Gu family head, Gu Xuesong, said indifferently, "Picked up halfway? Who knows what kind of trouble she might bring." From the eldest to the seventh brother, their response was unanimous: "We don't want a sister!" But this little girl, rejected by the entire family, proved herself after joining the Gu household. She resolved the business partner issues that even Gu Xuesong couldn't handle, bringing in so many contracts that they couldn't sign them all. She cured the Gu matriarch's chronic leg pain, to the point where the old lady was now striding around effortlessly... Even the seven Gu brothers, one after another, benefited greatly from her presence. It was only then that the Gu family realized they had brought home a treasure. From then on, the Gu family's attitude completely changed. The Gu matriarch: "Yao Yao, do you want some cream puffs? Grandma will buy them for you." Gu Xuesong: "Yao Yao, do you want a private jet? Daddy will have one sent over to take you for a ride." The Gu brothers: "Yao Yao, do you want..." And so, Yao Yao secured herself a meal ticket-one of the highest quality! ================== Note: get access to 30+ Advance Chapters on my patreon.com/flokixy
Met Her In Another World by Author_abeth
32 parts Complete Mature
After a tragic accident, David finds himself reincarnated in a mysterious and magical world. In this strange land, he experiences the highs and lows of his new life-moments of luck interwoven with immense challenges. By his side at every step is a captivating woman, whose presence gradually makes him fall deeply in love. Yet, David remains unaware of the biggest secret she carries. As David embarks on his quest, he grapples with questions that pull at his heart and soul. Will he succeed in the mission that brought him to this new world? Will he uncover the true purpose of his reincarnation? And most importantly, will he attain the love he's found, or will fate force him to leave it all behind and return to his real world? ~Read the story and I promise you will never regret.
Just let me sleep! by Seojun_hyung
18 parts Ongoing
She was just an innocent little girl who was starved for her family's love. Yet, they chose another young girl to be their happiness and threw her into a political marriage with North's monster-like prince. As she was on her way to her husband-to-be, she was faced with a mysterious monsters attack and experiencing her first feeling of happiness and care as she died. But she was send back in time where she is only 4 years old and apparently a boy? "Just leave me to sleep already!" She chose to live a lazy life but those annoying kids just wont leave her alone! Will she live peacefully and carefree this time?
A World with No More Pain!! (Male Reader X Anime MMORPG Harem) by JackDroid
30 parts Complete
You are Y/n L/n and You were A Loser With No Family and no Friends Just going to school and having A Miserable existence or that was until you saved A Girl from being hit by A Car and you woke up to Meet A Dragon God who Offers you A New kind of existence; The kind of You dream of; A MMORPG Anime world where you meet new Friends, Go On A New Friends, and Battle new Villians! You Might Finally have A Shot at A Wonderful Existence after all!
Strings of Fate by GeneticMonster
9 parts Complete Mature
What would you do if you were given another chance to live? Most people would take the blade to become the hero or an adventurer. Some want power or to make millions. This one just wants to make the world peaceful, but first he's gotta save his sister from the Goddess of Evil's grasp. He's forced to become a hero but not the way they want him to be. He was reincarnated because his soul was stronger than the rest, but is having a soul stronger than others mean anything? You may become powerful but that just means there's something far stronger than you. Alex awakened in an unknown area without any memory. The first thing he did was eat, because that was the only thing he could do. Welcome Wrath! This story is made for Mobile Users. If you want to read something that doesn't look nice read it on the Website. Cover art was found from google and does not belong to me. It is temporary. (CC) Attrib. NonComm. NoDervis
The princess refuses to die by JustBelowAndAbove
33 parts Complete Mature
A girl who only got shown hatred and disgust, she dies at the hands of her adoptive sister that everyone knows and loves. Her sister is from a place called Japan not only that she looks exactly like her mom!? After her death she wakes up to find people just like her sister and that her life that she has lived twice now was nothing but a lie!? But sometimes she can remember something that's never happened to her before...
The Modern Countess by AlexiaPraks
87 parts Complete
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
A Goblin's Leveling System by ShadowKatake
51 parts Complete
"Being a goblin isn't so bad. After all, I have a system for leveling!", Axel Everheart Axel Everheart is a top student at a famous high school with good looks and he is someone who has it all. Due to his ignorance, he slips on a banana peel on the street. He hit his head and well... he died! After his unfortunate death, he reincarnated as the fantasy world's ugliest and weakest mob, a goblin to be precise. Unwilling to accept his fate, he aims to become the strongest goblin and find a way to become a human again. With the help of his system, will he achieve his goal? _______________________________________ Edited Cover By: imagineTishaD Instagram: @imaginetishad _______________________________________ Written by: ShadowKatake Instagram: @katakekage ______________________________________
Volume 1 Chapter 1: Death? by null
Ongoing
Veil Of Eden by FreesiaEversor
18 parts Complete
The girl, or gregori, suddenly yelled in panic, "He took it!!! He took my wings!!! He's going to start it!!!!" She went and threw herself at Mike in panic, causing Uriel to nearly dislodge his flames at her if it weren't for Mike's glare to stand our ground down. Reincarnation. That word actually sucks more than I could describe. When you're related to the Angel Five, expect tons of being babied until you remember every detail and unleash your abilities. Sounds easy, right? Sadly, not everything goes into plan. When a demon claims to have a bond with you as some angels slowly lose their lives, things can get really icky, especially when one dark male seems to know more than he let on. I am Anariel, and I am the Guardian of the Veil, and this is me asking for help. © Copyright 2016 by Freesia Eversor. Under no circumstances can this be copied or reproduced. In doing so, you violate the copyright law.
You may also like
Slide 1 of 9
The little gluttonous child needs to eat cover
Met Her In Another World cover
Just let me sleep! cover
A World with No More Pain!! (Male Reader X Anime MMORPG Harem) cover
Strings of Fate cover
The princess refuses to die cover
The Modern Countess cover
A Goblin's Leveling System cover
Veil Of Eden cover

The little gluttonous child needs to eat

76 parts Ongoing

Yao Yao was born as a little glutton, her appetite rivaling half a mountain. One day, the old Taoist who adopted her passed away in meditation. At just three and a half years old, Yao Yao had no choice but to pack her small bag and head down the mountain to find her senior master. By chance, she ended up saving a wealthy tycoon from a car accident and became the adopted daughter of the prestigious Gu family. At first, everyone in the Gu family opposed the idea. The Gu family matriarch tapped her cane and said, "Raising someone else's child? Careful not to end up with an ingrate!" The Gu family head, Gu Xuesong, said indifferently, "Picked up halfway? Who knows what kind of trouble she might bring." From the eldest to the seventh brother, their response was unanimous: "We don't want a sister!" But this little girl, rejected by the entire family, proved herself after joining the Gu household. She resolved the business partner issues that even Gu Xuesong couldn't handle, bringing in so many contracts that they couldn't sign them all. She cured the Gu matriarch's chronic leg pain, to the point where the old lady was now striding around effortlessly... Even the seven Gu brothers, one after another, benefited greatly from her presence. It was only then that the Gu family realized they had brought home a treasure. From then on, the Gu family's attitude completely changed. The Gu matriarch: "Yao Yao, do you want some cream puffs? Grandma will buy them for you." Gu Xuesong: "Yao Yao, do you want a private jet? Daddy will have one sent over to take you for a ride." The Gu brothers: "Yao Yao, do you want..." And so, Yao Yao secured herself a meal ticket-one of the highest quality! ================== Note: get access to 30+ Advance Chapters on my patreon.com/flokixy

More details