Suprising change
Infinity-kun
  • Reads 4,784
  • Votes 139
  • Parts 15
  • Time 1h 40m
  • Reads 4,784
  • Votes 139
  • Parts 15
  • Time 1h 40m
Infinity-kun
Ongoing, First published Sep 16, 2020
chloecuteeinzbernfatefatekaleidfatekaleidlinerprismaillyafateseriegirlxgirlillyaillyasvielkaleidkurolgbtlovelovestoryluviamiyuprismaillyarinromancestorytwinyuri
Since Illya became a magical girl her life wasn't the same. She transformed into one with the help of her talking wand Ruby. Miyu also got one, Sapphire. Illya and Miyu are collecting all the class cards for Rin and Luvia. These are special Heroic spirits who are Saber, Lancer, Archer, Rider, Berserker and Assassin. Now Rin and Luvia got a call from the Mage Association. They should go to a spacial cavern, inject high-denisty mana into the power spot and expand the lay lines. Rin, Luvia, Miyu and Illya were went there and finished the ritual but something didn't worked out and unexpected happend...
Creative Commons (CC) Attribution
chloecuteeinzbernfatefatekaleidfatekaleidlinerprismaillyafateseriegirlxgirlillyaillyasvielkaleidkurolgbtlovelovestoryluviamiyuprismaillyarinromancestorytwinyuri
Table of contents

15 parts

Sign up to add Suprising change to your library and receive updates
or
#623yuri
Content Guidelines
You may also like
Chasing Sapphire by GulinaRehman
29 parts Complete
#12 in odd out of 4.3k stories. Royal army is after Sapphire after seeing her at ball, they are searching her because of her sapphire coloured eyes. Meet Sapphire an average village girl, living the fullest of her life, rearing cattle and working at fruit orchids, daydreaming about getting married to the love of her life. She have everything, she is satisfied with her life until the day she goes to the palace for ball and her life changes there. ~~~~~~~~~~~~~~~~~ This is not your cliche princess story from Disney. Get yourself ready for rollercoaster of emotions, unexpected turns, and uncover the real faces of sugarcoated people, face betrayal and decode the secrets.
The Emiya Of Teyvat (Fate Reader x Genshin Impact/FGO) by code_ghost15
39 parts Ongoing
(First take on a Genshin Impact book) The fifth grail war The day (Y/n) Emiya was killed by a servant. he won, but he lost at the same time, Being transported to teyvat and serving The Geo Archon himself was something he would do for saving him but 500 years ago the Cataclysm broke him, Not only that his brothers and sisters gone and his loved one aswell, So where is he? "I have to keep moving forward, To protect this world, And to protect those i care" -"(Y/n) Emiya" (Genshin Impact and FGO does not belong to me all rights belong to Hoyoverse and Type Moon)
(18+) Eterna Fiamma D'amore by CaseOfLillies
40 parts Complete Mature
"From the moment our gaze locked that fateful night, I sensed a seismic shift in my existence. Our journey has been one of rediscovery, navigating the intricacies of a love that transcends time and space." In this tale of intertwined souls, separated in a bygone era, fate orchestrates their reunion in the tapestry of a new decade. Yet, as memories from distant pasts resurface, veiled by the complexities of contemporary life, they are confronted with the ultimate question: can a love forged through the ages withstand the trials of modernity? Amidst the ebb and flow of life's unpredictable currents, Zayne's pursuit of enduring happiness forms the heart of this narrative. Though shadows may linger and challenges arise, the essence of this romance remains steadfastly illuminated, promising twists and turns while maintaining a hopeful, uplifting tone. Characters and parts of the story are based on the game Love and Deepspace. Greetings, everyone, and thank you for reading. I hope you enjoy the chapters as they come, as the story progresses, the pace of the timeline may vary. If you find certain parts confusing, please let me know, and I'll gladly attempt to provide clarification. Please consider saving, commenting, and/or sharing if you enjoyed the read!
Fate/Prisma Emilya by PhantomVenus
30 parts Complete Mature
Shirou Emiya or Emilya Von Einzbern have been gone through and experience in many unexpected situations. Being brought back to the living world from death? Already did. Living the rest of his life as a little girl with said little girl's body belong to his sister? Already am. Becoming a magical girl and becoming his lover's and friend's dress up doll? Sadly he already is one. Waking up in a different world and meeting people he recognized but same can't be said to them, oh and also collecting servant cards because he had no choice but to just bear with it. Damn you Zelretch!
Faye and Ruin by Rianna619
34 parts Complete
A week before her twenty fifth birthday, Azora begins having nightmares. Terrifying dreams of a world that doesn't exist. Shouldn't exist. When it becomes too much, she explodes and finds herself in a completely different realm full of Fae and all different types of magical creatures. As she learns of an ancestors imprisonment, she sets out on a quest to help bring her back. But the only way to do so is to allow herself to be prisoner to the very enemy that is seeking her death. Can she complete this quest, or will the obstacles become to great? Will she be able to push through the lies of the enemy, the kindness that one shows, to accomplish what has been her fate long before she was born or will things go sideways? **EDITING WILL COME SOON! A FEW LATER CHAPTERS WILL BE CHANGED BUT PLEASE COMMENT WITH FEEDBACK/NEEDED EDITS**
My Atlantis. (EraserMic x Reader.) by The_Queen_Boo
39 parts Ongoing Mature
(Shota Aizawa x Mermaid! Reader x Hizashi Yamada) Poly! -BOOK THREE of the Lush Life series! • One second, two seconds and the world had gone silent. Dark irises of the richest andesite meet mine, half-lidded gaze suddenly widening to silently showcase his own surprise. His hand is rough to the touch, just as I had presumed--calloused palm grazing over my skin so agonizingly slow. The feeling is coarse and his voice meets my ears in the same grainy manner, volume dropping to barely above a whisper when those sable brows furrow into a more annoyed expression. "Caught you." The man bites out, water trickling down his soaked figure and filling my senses with that lovely petrichor. 'Oh, fuck..' • • She had been perfectly fine within her solitude. Basking in the depths of the watery domain and completely unseen by human eyes, (Y/n) nurtures the creatures of the forest with lush foliage--her only ambience being the splashes of her movement and the gentle murmurs of creatures around her. Sadly, all peace doesn't last forever and that's evident when a grumpy man bursts through the thick greenery surrounding her pond. Crash landing and being stranded with his now injured gryphon--he seeks refuge beside the seemingly tranquil lake nestled amidst the dense forests. However, as strange occurrences begin to unfold around his campsite and his gryphon grows increasingly restless--his suspicions are drawn to their peak when things start going missing. Bound by circumstance and propelled by curiosity, the three are dragged into a journey of discovery when another lost soul goes out in search of his missing friend; A story where the bonds of understanding become a bridge between their separate worlds. • • • Bnha fantasy au~ "Fear of what one cannot understand." Warning: Mentions of gore, abuse, and light swearing. Suspicious tension, FLUFF, slow burn, and half enemies to lovers. Please point out grammar errors, English isn't my first language. ART NOT MINE
The Fake Innovator by Frozebudy98
5 parts Ongoing
Shirou Emiya have decided to forsaken his ideals and dreams of becoming a Hero of Justice and doomed the whole world for the sake of saving his little sister, Miyu, from her cruel fate. Unknowingly, his action has attracted the attention of the second magician whom decided to throw him away into a parallel world where he must save that world from its impending doom as a form of punishment for his selfish deed. How will his story play out?
Blade in Kivotos by aliceaileen
10 parts Complete
An Unsheathed Blade came to Kivotos along with his sister. Emiya Shirou is offered a job as a teacher, and a lot of things will change in the new world.
Fate/Ultimate Antagonist by XElenea
131 parts Ongoing
Getting Isekai'd to another world is indeed awesome, especially embarking on an adventure as a hero to defeat the Demon King, who turns out to be a woman, and making her part of your harem. It is truly the dream of millions of people hoping to be Isekai'd to another world. If Reinhard were to get Isekai'd like that, he might smile for the rest of his life. However, fate has other plans for him, as he becomes the unfortunate isekai victim, landing in the rabbit hole known as the moonlit world. With numerous psychopaths roaming around to fulfill their dreams, he must strive to defend his small life in this chaotic world, especially when the world is set to last only another decade. Fortunately, luck from nine generations of his family comes to his aid in critical moments. Finally, he gets help to secure his small life: [Ding!] "Eh? Has my help finally arrived?" [Congratulations, Host! You have been chosen as the host of the Antagonist Simulator System!] "Finally! Fina-... wait... What do you mean by Antagonist? Shouldn't it just be a Simulator without an Antagonist?" [As the name suggests, the Antagonist Simulator System is specifically designed for individuals with high aspirations to become antagonists, and you have been selected to be the Ultimate Antagonist! Congratulations, Host!] "Huh? Ultimate Antagonist? Wtf? How does someone as gentle as me fit as the ultimate antagonist?" [Not so.] [Host, you undoubtedly possess a strong motivation, clear plans, firm will, undisclosed secrets, outstanding execution, remarkable personality charm, and the determination to subvert the world.] [Undoubtedly, you are the perfect candidate for the ultimate antagonist.] WTF?
You may also like
Slide 1 of 9
Chasing Sapphire cover
The Emiya Of Teyvat (Fate Reader x Genshin Impact/FGO) cover
(18+) Eterna Fiamma D'amore cover
Fate/Prisma Emilya cover
Faye and Ruin cover
My Atlantis. (EraserMic x Reader.) cover
The Fake Innovator cover
Blade in Kivotos cover
Fate/Ultimate Antagonist cover

Chasing Sapphire

29 parts Complete

#12 in odd out of 4.3k stories. Royal army is after Sapphire after seeing her at ball, they are searching her because of her sapphire coloured eyes. Meet Sapphire an average village girl, living the fullest of her life, rearing cattle and working at fruit orchids, daydreaming about getting married to the love of her life. She have everything, she is satisfied with her life until the day she goes to the palace for ball and her life changes there. ~~~~~~~~~~~~~~~~~ This is not your cliche princess story from Disney. Get yourself ready for rollercoaster of emotions, unexpected turns, and uncover the real faces of sugarcoated people, face betrayal and decode the secrets.

More details