So Suddenly (ON HOLD)
slayy_babyy
  • Membaca 39,575
  • Suara 740
  • Bagian 19
  • Durasi 1h 27m
  • Membaca 39,575
  • Suara 740
  • Bagian 19
  • Durasi 1h 27m
slayy_babyy
Sedang dalam proses, Awal publikasi Sep 20, 2020
Dewasa
abusedaddictedanorexiarecoverybrokenbrokenfamilybrothersbruisesdrugsfamilyfatherforgivenessforgottenhateloveneglectnewfamilynewlifeselfharmstepbrotherssuicidalthoughtsteentrust
15 year old Amelia Bennett has had a hard life growing up. Having an alcoholic, drug addicted mother as well as an abusive step-dad really took all the fun out of her childhood. Life takes a turn when all of a sudden she's told she have 8 brothers and a father she believed was dead..
-------------------------

"So we got back the results from your DNA test. We've found your father and he is more than happy to take you in."
Seluruh Hak Cipta Dilindungi Undang-Undang
abusedaddictedanorexiarecoverybrokenbrokenfamilybrothersbruisesdrugsfamilyfatherforgivenessforgottenhateloveneglectnewfamilynewlifeselfharmstepbrotherssuicidalthoughtsteentrust
Daftar isi

19 bab

Daftar untuk menambahkan So Suddenly (ON HOLD) ke perpustakaan Anda dan menerima pembaruan
atau
Panduan Muatan
anda mungkin juga menyukai
Taunt oleh meepsahir
83 Bagian Lengkap
"Can we stop feeling guilty, Amelia? Guilty for all the things that weren't our fault." "We can Leo. Maybe someday." "That day isn't far off Amelia. I'll make sure of it." ___________________________________ There is a lot to think about when you find out your best friend has been raped and murdered. There is even more to think about when you're the last person she saw the night she died. But that's not what caused me to black out in the middle of a rocking party scene, surrounded by all the people I had known all my life. It was when I saw who had killed her. Hilarious, charming, the guy with the perfect quiff, and star quarter-back of the football team. He was loved by everyone. He was the guy you couldn't stay away from. Levi Harrison. My brother. ____________________________ #1 for General Fiction in The Grace Awards 2019 #1 College Romance 11/19 #3 Bullyingawareness 04/20 #2 Assault 06/20 • Started: August 2018 Ended: - January 2020 (Unedited) • WARNING: this book contains a mature theme, not suitable for all audiences. There are recurring themes of assault, mild depression, and violence. On the other hand: it'll put a big fat smile on your face! •Any media used belongs to it's rightful owners. No images or videos used belong to me.•
The Girl and Her Breaking Heart #1 || ✔ oleh Wildfire_247
48 Bagian Lengkap Dewasa
Alexandra Queen, she has never had a normal childhood. Her and her mother were abused by her father and his friend, John. Day in and day out. Their joy was her pain and suffering. No one knew of Alexandra's life at home. She was so good at hiding it, that even her own best friends didn't know what was going on. Alexandra eventually became a natural at hiding her pain from everyone. But one day her father stopped coming home. The abuse towards her and her mother stopped. No more drunken father or John beating and yelling at them. They were left alone. Free from them. They lived in peace for years. They were afraid of him coming back at first but when he didn't, they started their lives again. Willing themselves to push past their past. They began to rebuild themselves. But all that changed senior year. It seemed all fine at first. She made new friends and school was going great. She was ready to graduate. Then everything began to go downhill fast. Old friendships came back to haunt her. Secrets come to light and worst of all, they come back. Alexandra didn't think it could get worst then how she lived her childhood. But how very wrong she was. She then learns what it really meant to get the raw end of life. Follow as Alexandra deals with more then she thought she could handle. Alexandra might be strong willed but nothing could possibly prepare for what was to come. [Please keep in mind that this story is a very fast paced story. It does have around 40 chapters so it might not seem like it. But trust me that it is.] ||Full Disclosure|| I started the book in the end of 8th grade so it needs MAJOR editing. It also does have Sexual Chapters, as well as people of the same sex being together, murder, brutally torture talk of rape and sexual harassment. So if you do not wish to read things like that then this unfortunately isn't the book for you. ||You Have Been Warned|| First book in the Heart series. •Do Not Copy This Book In Anyway•
Drowning In The Dark (Broken Heirs #1) oleh Seventhjoul
49 Bagian Lengkap
The story of young girl being born by the rape of her mother and struck with her 4 brothers as her mom died giving birth to her. Being neglected and pleading for love for her brothers. She is now fed up. Now only 9 months to turn 18 she wants to move out early so asking permission from his eldest brother was the last thing she wanted to do. Join in her journey of her from being no one to becoming someone. Will her brothers let her go or make her stay? Read to find out!
Family Comes First oleh CRAZY40429
80 Bagian Lengkap Dewasa
Being alone? Check. Being afraid? Check. Being abused? Check times 3. Honestly, my life wasn't this bad before, not until I ended in foster care... SIKE! My life was always bad. From the moment I was born, I lived with an abusive father who blamed me for my mother's death, and even I couldn't disagree with him. Here are a few questions I am constantly asked: 'Do I do well in school?' No, are you kidding me? The only subject I'm good at is Visual Arts. 'Do I have a kind and caring family?' No, I don't think I do. 'Do I have anyone who cares about me?' No, I'm a loner and socially awkward. 'Do I have privileges?' No, if you haven't understood the message yet, I live in an abusive household. Now, you might ask if there are any questions the answer is yes. I'll give you some. 'Do I want to die?' Yes, I sometimes do. 'Do I feel alone in this world?' Yes, always. 'Do I get a beating every day?' Yes. *** This is Amara Williams, a 13 year-old with average grades and no friends. What happens when her only guardian, her dad, is dead? What happens when she finds out that she has five older brothers who are not only strict and demanding, but also protective assholes? More importantly, what happens when she finds out that she was taught lies from the moment she was born? Follow Amara as she digs deeper into her family history, uncovering the secrets and discovering the lies. ___ ⚠️ Trigger Warning ⚠️ There will be mentions of abuse, r@pe, self harm, death, and many other dark themes. I have given a warning now, and I will give a TW in each chapter when reading for safety reasons. However, I want all of my readers to know what to expect so that they can decided for themselves if they want to read. Read at your own discretion! ____ Highest Rankings: #1 in Rules: Oct. 18. 2020 #1 in Truth: Jan. 16. 2021 #1 in Alcohol: Jun. 18. 2021
Broken Beyond Repair oleh BlueDiamond_02
81 Bagian Lengkap
Alicia has been abused by her mom and step-dad for the past 2 and a half years, plus she has also been bullied for the past 2 and a half years. What happens when she finds out she has brothers. What brothers?The brothers she never knew she had. Will they get her to open up before it's too late. Will she open up to them? Or will she forever remain Broken Beyond Repair... Book one in the Series: Broken Beyond Repair Next book will be out soon ****Be aware this is my first time writing about abuse**** Also if you get trigger by that sort of subject, either skip it, or when I have time I will go and put a warning before and after it 13+ There are some scenes i need to change its not bad and there is no blood but i need to lighten them a bit :) Started 30th January 2021 Finished the 9th of May 2021 All right reserved DO NOT COPY MY BOOK BY Blue.Diamond_02
Little Sunshine | ✓ oleh LissyLisafou10
44 Bagian Lengkap Dewasa
"𝐒𝐡𝐞 𝐰𝐨𝐮𝐥𝐝'𝐯𝐞 𝐭𝐚𝐤𝐞𝐧 𝐚 𝐛𝐮𝐥𝐥𝐞𝐭 𝐟𝐨𝐫 𝐭𝐡𝐞𝐦, 𝐛𝐮𝐭 𝐭𝐡𝐞𝐲 𝐰𝐞𝐫𝐞 𝐭𝐡𝐞 𝐨𝐧𝐞𝐬 𝐡𝐨𝐥𝐝𝐢𝐧𝐠 𝐭𝐡𝐞 𝐠𝐮𝐧." ▪︎▪︎▪︎▪︎▪︎ Alaska Hades had six older brothers, a loving father and an abusive mother. She was hiding away in the shadows, fearing that her mother would hurt anyone else as well if she didn't keep her mouth shut. But after a horrific accident, Alaska was blamed for something she had never done and was sent to a boarding school for delinquents. Away from her family, away from her home, away from everyone she had once loved. After five years of dealing with the betrayal and pain on her own, Alaska was forced to return to her old home. With a dysfunctional family, new family additions, her mother's death, familiar faces of old friends and a certain bad boy in school, that everyone warns to stay away from, Alaska is in for a time like no other. Will her family ever find out the truth? And if they do, will it be too late? Or will she become their Little Sunshine again? - 𝙉𝙊 𝙎𝙀𝙓𝙐𝘼𝙇 𝘾𝙊𝙉𝙏𝙀𝙉𝙏! 𝙏𝙍𝙄𝙂𝙂𝙀𝙍𝙒𝘼𝙍𝙉𝙄𝙉𝙂: 𝘢𝘣𝘶𝘴𝘦 𝘢𝘯𝘥 𝘴𝘦𝘹𝘶𝘢𝘭 𝘢𝘴𝘴𝘢𝘶𝘭𝘵; 𝘥𝘦𝘢𝘵𝘩; 𝘢𝘭𝘤𝘰𝘩𝘰𝘭 𝘢𝘣𝘶𝘴𝘦; 𝘣𝘶𝘭𝘭𝘺𝘪𝘯𝘨; 𝘥𝘦𝘱𝘳𝘦𝘴𝘴𝘪𝘰𝘯.
She would persevere oleh SaarJT
69 Bagian Lengkap
How would you feel when the world you grew up in crashed and burned? What if you were tossed into one that was all about survival? Would you persevere? Or would you crumble? Follow Adelaide when she tries to make sense of what her world has become. What would happen if she was tossed back into the world that broke her? Her world that consisted of her family, her brothers, her sister. Would she forgive and forget? Will she persevere or will she crack? Welcome to my first ever book, please give it a try. I post minimum twice a week! I will try to say it won't be as cliche as your standard family story. Started: 07 feb 2022 Finished: 10 April 2022 #1 perseverance - 03/03/2022 #6 abandoned - 03/03/2022 FULLY LICENCED AND FULL COPYWRIGHT
Unconditional Love oleh ShantaAddison
95 Bagian Lengkap Dewasa
'You can't have a testimony, without a test.' How much heartache can one person have before enough is enough? Layla has had the best and worst experiences a woman can ever imagine. As soon as she thinks she has found peace, her world is turn upside again. It's a repeated cycle, and her spirit is growing weak. 'You can't have your cake and eat it too.' Kenneth thought he was going to be able to enjoy the best of both worlds. He was until jealousy and envy snuck into his domain. He had to make a choice that would forever change his world. Will it be for better or worse?
Sparks Reignited (The Extended Hobson Family Trilogy: book 2) oleh tagny11
30 Bagian Lengkap
It's been six years since Amelia graduated from high school. Her life is going great. She has more money than she will ever need. A place to call home with her brother and niece. A dad that is there for her when she needs him to be. An uncle and cousins she didn't even know she had seven years before. Grandparents that spoil her, even though she is 24 years old. The best pastor she has ever had and his wife that treats her almost like a daughter. The parents of her dead childhood best friend that brought her in after her step dad died. Plenty of friends to do things with. Yet still something is missing from her life. It's the only thing she doesn't know she wants, love. When her old crush comes back to Hobson, will she fall in love with him all over again, or has she moved on?
A Cry Out To Jesus (The Extended Hobson Family Triliogy: Book 1) oleh tagny11
39 Bagian Lengkap
All Amelia ever wanted was to have a normal life. To have her parents married forever, her big brother there for her, to have lots of friends, and follow Jesus Christ. Things go the whole opposite direction for her. Her mom and dad divorce, her brother becomes a drug addict, and her only friend moved away their sophomore year at high school. Things began to start looking up again when she learned to love her step-dad, and then he died unexpectedly from a heart disease. Her whole life is falling apart, so is her relationship with God. She has stopped going to church and hasn't touched her Bible in months. Then her dad comes to her rescue. He takes Amelia away from her old life and depressed Mom, to a new town and a new life. What does this new life hold for Amelia? Only God knows.
anda mungkin juga menyukai
Slide 1 of 10
Taunt cover
The Girl and Her Breaking Heart #1 || ✔ cover
Drowning In The Dark (Broken Heirs #1) cover
Family Comes First cover
Broken Beyond Repair cover
Little Sunshine | ✓ cover
She would persevere cover
Unconditional Love cover
Sparks Reignited (The Extended Hobson Family Trilogy: book 2) cover
A Cry Out To Jesus (The Extended Hobson Family Triliogy: Book 1) cover

Taunt

83 Bagian Lengkap

"Can we stop feeling guilty, Amelia? Guilty for all the things that weren't our fault." "We can Leo. Maybe someday." "That day isn't far off Amelia. I'll make sure of it." ___________________________________ There is a lot to think about when you find out your best friend has been raped and murdered. There is even more to think about when you're the last person she saw the night she died. But that's not what caused me to black out in the middle of a rocking party scene, surrounded by all the people I had known all my life. It was when I saw who had killed her. Hilarious, charming, the guy with the perfect quiff, and star quarter-back of the football team. He was loved by everyone. He was the guy you couldn't stay away from. Levi Harrison. My brother. ____________________________ #1 for General Fiction in The Grace Awards 2019 #1 College Romance 11/19 #3 Bullyingawareness 04/20 #2 Assault 06/20 • Started: August 2018 Ended: - January 2020 (Unedited) • WARNING: this book contains a mature theme, not suitable for all audiences. There are recurring themes of assault, mild depression, and violence. On the other hand: it'll put a big fat smile on your face! •Any media used belongs to it's rightful owners. No images or videos used belong to me.•

Detail lengkap