clawing through the blocks.
mentallyKDJ
  • Reads 6,557
  • Votes 348
  • Parts 24
  • Time 5h 22m
  • Reads 6,557
  • Votes 348
  • Parts 24
  • Time 5h 22m
mentallyKDJ
Ongoing, First published Oct 03, 2020
Mature
adventuredantdmdreamdreamnobladefantasyjacksepticeyemarkipliermcminecraftrpgseptiplierstampylongheadtechnobladetommyinnitwilbursoot
One game, One World, One villain. Eight players have been transferred into the Minecraft world for one task. And that is to defeat an evil being roaming around the game. 

TWs:
- Strong Language
- Violence
Public Domain
adventuredantdmdreamdreamnobladefantasyjacksepticeyemarkipliermcminecraftrpgseptiplierstampylongheadtechnobladetommyinnitwilbursoot
Table of contents

24 parts

Sign up to add clawing through the blocks. to your library and receive updates
or
Content Guidelines
You may also like
I'm not a bad guy, I promise by Angelboy3434
21 parts Complete
Tommy has been taught to be a villain, even though he doesn't want to be one. Until he's kidnapped by the superheroes. ~~~ Phil, Techno, and Wilbur see a villain's side kick and asked "Is anyone gonna save that" and don't want for an answer
SBI Oneshots by Fanta321123
80 parts Complete
Oneshots but SBI invaded and you cannot escape the lovely fluff and paining angst
Always The Villian (Disc Duo Switch Role AU) || Tommy & Dream [Dream SMP] by ItzWolfie_20
23 parts Complete Mature
After being exiled for so long, after being stuck in prison for a very long time; Tommy and Dream had one difference in each other. One wants to be the good guy awhile the other wanted to be the villain of this story, Dream never wanted this but for Tommy? He wanted to be the villain, the villain of this story. And what will be the cause? Is it peace? Or will it be just like how it will always be? ----------------------------------------------- ‼️THE CHARACTERS WRITTEN IN THIS STORY DOES NOT BELONG TO ME EXCEPT THE WRITING. CREDITS GOES TO THE ORIGINAL OWNER OF THE THUMBNAIL.‼️ ⛔ Anything written in this story does not connect to the Dream SMP. This is just an AU. This story will mention/have heavy swearing, violence and character's death.⛔ ----------------------------------------------- Characters: • Tommyinit • Philza Minecraft • Wilbur Soot • Technoblade • Tubbo • Ranboo • DreamWasTaken Date of the story publish: • March, 30th 2022 Chapters: • 22/22 Original writing posted on: https://archiveofourown.org/works/38056102/chapters/95056918 Writing completed: ✅
Jacksepticeye Imagines by Alanornala
122 parts Complete Mature
Short stories/ imagine for the one and only Jacksepticeye. These are my first imagines so they might be a little rough. But I'll write long, short, shipping etc. Requests were taken and some have been written in here :) {Completed with 100 chapters} !!Some chapters/updates are Mature!!
LOSING GAME ➳ dreamwastaken by savsnothere
53 parts Complete
i've spent all of the love i saved, we were always a losing game. 𝙄𝙉 𝙒𝙃𝙄𝘾𝙃 the boy king falls in love with the pauper, but the two star-crossed lovers are driven apart by the horrors of war OR! reverie loves dream too much to let him go, even when power makes him lose himself c!dream x fem!oc dream smp , mcyt savsnothere - 2021
MCYT Angst One-Shots by kazoojoy
12 parts Complete Mature
CONTAINS MATURE CONTENT !! REFER TO THE TRIGGER WARNINGS AT THE TOP OF EACH CHAPTER !! Welcome to just another MCYT angst one-shot book! I hope you'll enjoy it! Make sure to check out the welcome chapter to see what it's all about here, it's has all of the story information! Please read the trigger warnings above each chapter, skipping a chapter or two won't hurt <3 And with that, let's get to it! Love ya! Stay safe! January 15th - 1k reads March 4th - 3k reads May 9th - 4k reads July 11th - 7k reads September 16th - 10k reads Completed: May 08, 2021
your fanboy | markiplierxreader by mcuharry
23 parts Complete
where you're the youtuber fanboy AU ‐------------ fair warning: i wrote this when i was 13 and its rushed and sucks. if you read it, i am so sorry Highest ranking in markiplier #10
Bang and Burn ~ Dreamnotfound + Skephalo by P0tatocake
43 parts Complete Mature
Cover art done by my friend Aoife, you can commission her at aoifeskye23@gmail.com or check her out under 🌌Aoife Skye🌌 on Pinterest! A one night stand plunges George into the world of spies and special intelligence, where he is recruited to seduce a man to get insider information on a string of murders. George knows three things for certain: 1) His best friend Nick has been an agent as long as he's known him 2) His one night stand is his target 3) He has no idea what he signed up for *Warnings* There will be: Language Guns Other epic spy stuff Started- July 7th A/N- This is a fanfic. I do not ship the irl people mentioned in the story and will take this story down if anyone expresses that they don't feel comfortable with stories being written.
The Dragon tamer | SapnapXOC by GattaGamer00
57 parts Complete
The dream team gets teleported in the minecraft world by some weird kind of magic, while they try to find a way out they decide that beating the game might get them home. But something feels... off. Trees missing, villagers already maxed out and... a road... not a natually generated one like in the villages, but a manmade one. Turns out they are not alone in this world. WARNING: THIS WILL CONTAIN BLOOD, PANIC ATTACK, YA KNOW THE DRILL, THE USUAL, SO BE WARNED. 2° on #dreamteam pog!! 13/06/2021
Dreamnotfound One Shots by -gogy-
27 parts Complete
I decided to take part on this! Here are one-shots about Georgenotfound and Dream, two amazing youTubers and people! Disclaimer: Both Dream and George explained they are alright with fanfiction. Upon request, I will remove these stories. With that out of the way, enjoy! Cover art created by @dreamwasonfire on Picuki
You may also like
Slide 1 of 10
I'm not a bad guy, I promise cover
SBI Oneshots cover
Always The Villian (Disc Duo Switch Role AU) || Tommy & Dream [Dream SMP] cover
Jacksepticeye Imagines cover
LOSING GAME ➳ dreamwastaken cover
MCYT Angst One-Shots cover
your fanboy | markiplierxreader cover
Bang and Burn ~ Dreamnotfound + Skephalo cover
The Dragon tamer | SapnapXOC cover
Dreamnotfound One Shots cover

I'm not a bad guy, I promise

21 parts Complete

Tommy has been taught to be a villain, even though he doesn't want to be one. Until he's kidnapped by the superheroes. ~~~ Phil, Techno, and Wilbur see a villain's side kick and asked "Is anyone gonna save that" and don't want for an answer

More details