Story cover for Everybody Gangsta Until Science Meets Magic by FeralNeko
Everybody Gangsta Until Science Meets Magic
FeralNeko
  • WpView
    Reads 14,050
  • WpVote
    Votes 784
  • WpPart
    Parts 61
  • WpHistory
    Time 8h 48m
  • WpView
    Reads 14,050
  • WpVote
    Votes 784
  • WpPart
    Parts 61
  • WpHistory
    Time 8h 48m
FeralNeko
Ongoing, First published Oct 05, 2020
Mature
adventurefantasyfightingisekaimagicmagicpowersmalemartialartsmultiverseotherworldparalleluniversereincarnationromanceslowromanceswordfightingswordsmanshipsystemthirdpersonuniverseworldbuilding
Magic is usually all about bending the laws of reality and such, but in this world, magic coexists with science.

You could synthesize water, produce crackles of lightning with electrons, or manually purge the carbon atom in the carbon dioxide molecules in your lungs so you don't need to actually breathe--

You could install free air-conditioning wherever you go, equip yourself with night vision by multiplying photons that come close to your eyes, or float by creating enough upward acceleration to counteract gravity--

OR you could make uranium 235 along with some plutonium 239 to level cities, OR crash the economy by synthesizing precious minerals non-stop, OR create a supercomputer with the wits and wisdom to be able to take over the world--

It should be obvious by now.

Everybody gangsta until science meets magic.
All Rights Reserved
adventurefantasyfightingisekaimagicmagicpowersmalemartialartsmultiverseotherworldparalleluniversereincarnationromanceslowromanceswordfightingswordsmanshipsystemthirdpersonuniverseworldbuilding
Table of contents

61 parts

Sign up to add Everybody Gangsta Until Science Meets Magic to your library and receive updates
or
Content Guidelines
You may also like
Arifureta (Y.N, The Magic Creation Archer) (Original Character MC) by TheEmuCaptain
44 parts Ongoing Mature
What if someone was summoned to another world... ...with the power to control every element-Fire, Water, Wind, Earth, Light, and more? What if that person wasn't a cold and vengeful warrior, but a quiet, kind soul-someone who still longed for home, yet chose to help those in need with compassion and strength? Even if the world is against him....? Welcome to my first Arifureta fanfic. A story of power, combined with a heart of gold. This is a story where a male Original Character (OC) replaces Hajime as the protagonist. While his goal is still to return to Earth, his journey is filled with wonder, friendship, and growing bonds-with a deep focus on treating his partners with love and warmth. Yes, that includes the original harem from the anime. Kaori, Shizuku, Shea, the others as well. Do expect a good plenty of games, songs and movie references in this story! ♥♦♣♠♥♦♣♠♥♦♣♠♥♦♣♠ Any images included in the story are for fun, character visualization, and lore-building-including depictions of the girls in his harem. I also don't own the anime or any properties that are used in this story. It belongs to their respective owners. I hope you like this story. Just like any other stories made, they are often not easy to make. Also, this is just a story of fiction, guys. No need to get too serious. Let me put my think cap please. Or I guess in other words. Let me "cook" and also "lock in" with all I can. Thanks for reading my story-and enjoy the journey! Milestones (Frontier): ✓ 6000 reads! ✓ 7000 reads! (Thank you guys..... This is insane!)
Be Natural by inverted_12
25 parts Complete Mature
The near future world looks grim for all life on earth. It is nothing that we expected by the 22nd century. After a devastating 3rd world war which has wiped more than half of all life on earth, has been destroyed by humanity's greed and over use of Technology. It would be a long 65 years after the 3rd world war untill a young man came along and changed everything with his mysterious magical power. Auther note: Be Natural is a series that I am creating that tackles real world problems with a fictional story. This is book 1 out of many, I have planned many seasons for this series. This first book is just the introduction to the main characters, power system, world building and setting. If you do enjoy reading my book's then please comment on them i am very interested on what you think.
Tea Time and Cookies: A (Not So) Quiet Beginning by AlphaNyte
58 parts Ongoing Mature
Life ended quietly. Rebirth? Not so much. I'd lived a perfectly normal nerd-life: a family, a career, too many hobbies, and a purse full of "just-in-case" items. Gardening, old crafting techniques, reading, manga, animé-especially the alternate-world kind. If I had one regret, it was not traveling as much as I'd wanted. But all things end eventually. I expected nothingness... or whatever reward awaited after a long, fulfilling life. Instead, I woke up to the very real problem of a massive creature trying to eat me. I'd been reborn into another world. I should have been thrilled, right? With very little to go on-aside from the fact that magic existed here-I decided the smartest approach was to keep a low profile and train like crazy. Survive first. Explore later. My new family seemed pleasantly surprised (and occasionally alarmed) by my dedication to both physical and magical training. And once I started attending school, I made fast friends... then accidentally convinced them to apprentice under my father. The more the merrier, I figured. But hiding my abilities is proving harder than expected, and the more I grow, the more certain people seem unsettled by my existence. Surviving to adulthood may be the real challenge. *This is slowburn coming-of-age with early magic training, not a romance story-yet. **This series is marked Mature not for explicit content in this book, but because future volumes will contain heavier scenes. I prefer to err on the side of caution. ***I am a Canadian author. English spelling follows Canadian usage. ****Cover created with AI assistance using Canva.
Order of the flaming dragon first war by samhasleyhunwick
24 parts Ongoing
there was a method of fan fiction that I'd like to create here. it being a new perspective on the movement of a character through time. and as a blocker they forgot about the memory lost to time. as the Counsel of Continuity has been changed to take care of the chosen. he who dose not see time as they do. they are beings outside of time and the future, past present it's All the same to them. The Realm is now known as Alanari over 100,000 years after the stone worriers, and the dragons rising to power, of the order of the flaming dragon where just stories to tell the youngsters to frighten them into behaving. the year is 24/09/101725cycle's since the gods first spoke to humans. And the order was wiped out reveling the land below the ice. It's been 1200 years since, then there was been a Power struggle between the undead factions and the mountain men of the south. a secret tribal United Front called the Tribe of the Un-ith-Ka the first attempt at uniting all tribes on the plain under one banner. attempts on the life of the king and his offspring has increased since the Mountain Men and the Undead army spread their Rule over all of Un-ith-Ka they are ransacking and pillaging all across the land. nobody knows where the plains of manna stream from. but over the last 100,000 years there has been some development in understanding magic, and they have incorporated it into everything, but only those with the sensitivity to Magic and the intelligence of logical more scientific way. they are called the Sci_magi they believe in a ordered Universe where the wielders of magic contribute to the entire civilization. science and magic mixed together as one. as the line between this plain Un-ith-Ka and the plains of Magic have grown thin and beings known as Demons have flooded through at some places where the veil between worlds has thinned out. the first demon's where powerful.
Dreaming about world domination, and other deliriums by Joanne_carper
107 parts Ongoing Mature
Falling asleep on the bus during commute and waking up in a forest? I must clearly be dreaming, if that's the case I'll make it as fun as possible~ Waking up as a young demon girl, attacked by an army, and somehow getting rid of them easily, things look rather easy here, I'll see how far I can get, town, cities, kingdoms, maybe even the world, sky's the limit in a lucid dream surely. Demon lord, prophecies and wars? The church, budgets and political interactions?, everything it's a huge pain. All I wanted was some fun but now I have people I quite like to protect. Still this dream sure it's long, I wonder when will it end? Until then, I'll continue doing what I like, and following my gut to see where I end up. ** My own take on the classic isekai plot of an op mc, crossposting with scribblehub! Chapters usually upload on mondays and sometimes fridays, though here we'll have chapters daily until we reach the other platform!
The Modern Countess by AlexiaPraks
87 parts Complete
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
CHANGING THE PLOT! (var!KNY x Modern!Reader) by fxkiivp
6 parts Complete Mature
In which a young author cannot be consistent with books and easily gets bored of it discontinued this book. HAHAHA SUCK BALLS!! Anyone can take the book, i really don't care lol. Adopt it, add on to it, change it, idc, do wtv. ➥🔍𝗜𝗡 𝗪𝗛𝗜𝗖𝗛 a 19 year old girl, named Y/N L/N, gets hit by the infamous truck-kun and ends up in Kimetsu No Yaiba. Will she die in this world infested with demons? Or will she catch the hearts of everyone, unintentionally..? What's happens next is shocking! (real ones know.) OC x reader KNY!var x reader ⚠️𝗪𝗔𝗥𝗡𝗜𝗡𝗚𝗦⚠️ VIOLENCE BLOOD GORE INSENSITIVE JOKES SEXISM (POSSIBLE) GOREY DEATHS D0UM@.. SWEARING (POSSIBLE) HARRASMENT NO SMUT! (i'm a middle schooler :c) ONLY WHOLESOME SCENES! (i despise such insects as D0UM@) The Reader will be a curvy, female, reader. She will be medium height so around 5'4-5'5, bottom and top reader. For plot purposes she will have muscle and be a bit toned. Everything else is up to you. DEFINITELY NOT A SLOW BURN 😔 This is an x reader story but it's not rlly the main point of the plot, so don't be annoyed when there isn't a lot of lovey dovey scenes. I fucking hate angst, so don't expect it. HEAVILY INSPIRED OFF Demon Slayer[Spoiler Alert!], PLEASE GO CHECK IT OUT ITS LITERALLY SO GOOD AND FUNNY! I LOVE IT! The "SYSTEM" idea is from MHA x Reader FANFICs, im unsure of what it is called but i think it's "REPROGRAM" and "ALTRUISM". Please go ahead and check them out! Credits to them for the "SYSTEM" idea :3
The Reluctant Angel by Evan_D_Sherden
23 parts Ongoing
"I just wanted to go back to my boring office job. Instead, I got hit by a truck, reincarnated as an impossibly beautiful angel, and now everyone thinks I'm either a saint or marriage material. Did I mention I'm male? Because apparently nobody believes that part." Dawn afterlife is not going according to plan. One moment he's contemplating toilet paper brands, the next he's standing before five ancient dragons being declared "the chosen one." With reality-breaking charm stats, legendary healing powers, and angel wings he didn't know he had, Evan just wants to run a quiet clinic and avoid attention. Too bad the universe has other plans. Between accidentally becoming the most famous healer in the kingdom, receiving marriage proposals from nobles who think he's a teenage girl, and somehow defeating monsters that should have turned him into paste, Dawn simple dream of normalcy is looking increasingly impossible. And that's before the Church, the royal family, and various other powerful people start taking an interest in his "miraculous" abilities. With only Esme, his sarcastic fairy guide, to help him navigate this chaotic new world, Evan must figure out how to be a hero when all he really wants is to heal people and maybe not get mistaken for a girl every five minutes. A hilarious isekai adventure about
The Root Of Magic by BrucejordanAnderson
6 parts Ongoing
Two nations locked in a three century long struggle for dominance in which neither side showed any sign of giving in. That was until one nation conceived of a weapon that would have dire consequences for the world. The supersoldiers known only as "Mages." The war is won and the people can now at last live in peace. Or at least that is how it should have been... Mages have been condemned as they have been deemed too powerful by "the Council." Inquisitors have been sent out to find any who remain and their orders are clear. Subjugation or destruction. Countless lives have been taken. Families torn apart. Freedom sounds like a distant dream. Yet one person may yet have the power to save the world. Or destroy it.
I Became The Scoundrel In The Popular Dating Sim by Ares_00_
135 parts Ongoing Mature
Pro Tip: Never play a game 100 different times, no matter how addicting it is! ~My Lovely Harem School Life~ Just like the cringy name suggests, it's a well-known dating sim that gained popularity due to the beautiful heroines, fun story, and most importantly, the significance of the player's choices that influence the endings. ...But why did I end up transmigrating into the scummiest character in the game, Yagami Reiji, the heir to the biggest Yakuza group in the country? The trash that harassed the main cast, the trash that bullied the students, and the trash that ultimately 'steals' the heroines if the player makes the wrong decisions. A walking bad ending. Why me? And out of every possible role... why him? Now, I'm trapped in a life that isn't mine, surrounded by classmates who flinch at my presence and a father who expects me to inherit an empire built on blood. Can I rewrite Reiji's fate before his past drags me down with him? Can I live a normal school life when the shadows of the underworld are watching my every move? I've got multiple targets on my back, a reputation in flames, and to make matters worse, the original protagonist is somehow a complete moron. This isn't a dating sim anymore. This is my reality..... *** Patreon: patreon.com/Ares_00 You can access: - Up to 30 advance chapters - Updated Character Images (Free) - Fun and interactive polls - Private community - Fan requests - And MUCH MORE
You may also like
Slide 1 of 10
Arifureta (Y.N, The Magic Creation Archer) (Original Character MC) cover
Be Natural cover
Tea Time and Cookies: A (Not So) Quiet Beginning cover
Order of the flaming dragon first war cover
Dreaming about world domination, and other deliriums cover
The Modern Countess cover
CHANGING THE PLOT! (var!KNY x Modern!Reader) cover
The Reluctant Angel cover
The Root Of Magic cover
I Became The Scoundrel In The Popular Dating Sim cover

Arifureta (Y.N, The Magic Creation Archer) (Original Character MC)

44 parts Ongoing Mature

What if someone was summoned to another world... ...with the power to control every element-Fire, Water, Wind, Earth, Light, and more? What if that person wasn't a cold and vengeful warrior, but a quiet, kind soul-someone who still longed for home, yet chose to help those in need with compassion and strength? Even if the world is against him....? Welcome to my first Arifureta fanfic. A story of power, combined with a heart of gold. This is a story where a male Original Character (OC) replaces Hajime as the protagonist. While his goal is still to return to Earth, his journey is filled with wonder, friendship, and growing bonds-with a deep focus on treating his partners with love and warmth. Yes, that includes the original harem from the anime. Kaori, Shizuku, Shea, the others as well. Do expect a good plenty of games, songs and movie references in this story! ♥♦♣♠♥♦♣♠♥♦♣♠♥♦♣♠ Any images included in the story are for fun, character visualization, and lore-building-including depictions of the girls in his harem. I also don't own the anime or any properties that are used in this story. It belongs to their respective owners. I hope you like this story. Just like any other stories made, they are often not easy to make. Also, this is just a story of fiction, guys. No need to get too serious. Let me put my think cap please. Or I guess in other words. Let me "cook" and also "lock in" with all I can. Thanks for reading my story-and enjoy the journey! Milestones (Frontier): ✓ 6000 reads! ✓ 7000 reads! (Thank you guys..... This is insane!)

More details