Story cover for The Valkyrie by WhiteWolfe32
The Valkyrie
WhiteWolfe32
  • WpView
    Reads 12
  • WpVote
    Votes 1
  • WpPart
    Parts 1
  • WpHistory
    Time 38m
  • WpView
    Reads 12
  • WpVote
    Votes 1
  • WpPart
    Parts 1
  • WpHistory
    Time 38m
WhiteWolfe32
Complete, First published Oct 15, 2020
Mature
apocalypsebadassblackrunbossfemaleevilfantasyfemalefemaleprotagonistfictiongodsgoodoyelpowersrisensci-fisci-fi-fantasysocietystrugglesuperpowerssurvivaltimemachinetimetravelvalkyriewayback
Welcome to Blackrun, the city that bleeds black. Thousands of years in the future, society depends on Oyel, a sustainable energy source. But how sustainable is it really? In fact, Oyel is the blood of the Quasi, government experiments with superhuman strength, speed, and intellect.
When the Quasi stage a rebellion, the human race finds out the truth about Oyel. The Quasi, turned angry and bitter, feast on human flesh to satiate their rage. The Risen, the creators of the Quasi, use this turmoil to do whatever they please. One Risen, Lyre, is on a quest to find a time machine. Along the way he meets Valkyrie, just your average apocalypse survivor. But there are secrets buried in Blackrun... on both sides.
All Rights Reserved
apocalypsebadassblackrunbossfemaleevilfantasyfemalefemaleprotagonistfictiongodsgoodoyelpowersrisensci-fisci-fi-fantasysocietystrugglesuperpowerssurvivaltimemachinetimetravelvalkyriewayback
Table of contents

1 part

Sign up to add The Valkyrie to your library and receive updates
or
Content Guidelines
You may also like
Against the Divines by maxraywhite
15 parts Ongoing Mature
In a reverse world where gods make contracts with mortals to fight for power and prestige, Bell , a fragile yet defiant boy with white hair and white eyes, finds himself enslaved and forced to fight for his survival. In this reversed society, where women dominate the battlefield and bed men are often reduced to househusband or slaves, Bell's fate seems sealed. But instead of succumbing, he rises to challenge the cruel expectations placed on him. As Bell faces terrifying beasts and powerful opponents, he uncovers hidden abilities that shock even the gods. In a world where humans are seen as inferior, and magic determines worth, Bell must unlock his potential to break free from the shackles of fate. Blending elements of dark fantasy, action, and reverse gender dynamics, this story follows Bell as he navigates a brutal society dominated by powerful female warriors, while uncovering secrets about his past that could change everything. The battle for survival, power, and freedom has only just begun, and Bell's rise will shake the very foundations of this world. His journey is one of defiance, determination, and a fate he never wanted-but one he must claim.
Excalibur {Complete} by CaraAisling
32 parts Complete Mature
**WARNING: Depictions of drugs, rape, and violence are within this book.** The world is in ruin. Destroyed by the powers that governed it in all out war years ago. The only sense of order that remains now are those belonging to gangs. Gangs have control over food, water, any valuable resource. Without a gang, survival was near impossible. But being a part of one had its dangers as well. Turf wars. Violent destruction. Death. Valkyrie's boyfriend is the leader of a gang whose sole purpose it seems is to wage war on everyone else. It is chaotic, and dangerous. Valkyrie decides it's better to flee from the insane man than stick around for much longer and risk death himself. He finds himself in the hands of another gang, and in the middle of a gruesome war between the two rivals. But it's not just a fight between the gangs that is rising. There's something else brewing on the outskirts. A drug is being passed around. A dangerous one. With high results, and even higher consequences.
We Were Stardust Once by rrrick_grimesss
27 parts Ongoing
They were born from the stars, but the world refuses to let them stay. It has been three years since the Genesis Flares, the solar phenomenon that gave birth to Astrans: beings with abilities beyond human comprehension. Some see them as miracles, others as abominations but to those in power, they are a threat that must be controlled, exploited, or eradicated. Fear spreads like wildfire, and war is inevitable. Among the displaced and the hunted, a survivor fights to carve out a future for her people, refusing to let them be erased from history. By her side stands the one who saved her, a sister in all but blood, a friend who has vowed to protect her, even if it means keeping dangerous secrets. As alliances fracture and loyalties are tested, they must navigate a world that has already decided what they are: enemies. In the heart of the conflict, two minds once dedicated to progress now wrestle with the weight of their own creations. One, a scientist bound by failing health, seeks to undo the greatest mistake of his life before time runs out. The other, an engineer thrust unwillingly into war, struggles between duty, regret, and the burden of being the only one left to fight. Lines blur between vengeance and justice, survival and sacrifice. The choices they make will determine not only the outcome of the war but the future of the Astrans themselves. Before the war, before the fear, they were all the same. They were all stardust once.
Immortal in The Apocalypse by ColorfulAutumnWind
43 parts Complete Mature
Born as a true god, Zhu Lin shoulders heavy responsibilities throughout her life. After her tribulation failed, she fell into a small world --- a world where zombies and mutants were rampant. Coming to this new world, she tried to find a way to return to the Six Realms, but discovered a long-forgotten truth instead. Faced with reality, she is forced to make a choice, where one wrong choice could destroy the entire world...
Aevum by HolyRetribution
27 parts Ongoing
After a catastrophic accident all of existence had collapsed into a single world, massively accelerating the evolution of mankind as people begin to awaken abilities and powers. Some assume the mantle of superhero's and saviors, while others use their newfound strength to accomplish more dastardly goals and ambitions. Humans slowly begin to realize that the earth they once knew is no more. As monsters, demons, angels, gods and beings of fairy tales begin to reveal themselves en masse. Even those that had perished long ago had somehow been brought back to life in this catastrophe with nothing separating the land of the living from that of the dead. Faced with new dangers and new allies humanity finds itself at the brink of extinction while the ones that caused this catastrophe try desperately to restore the world to what it once was. The laws of the jungle and the laws of the universe are king in this new world where death waits around the corner hungry and lurking for his next victim. Can Ethan restore the world he once knew as his home or will he be forced to adapt to this new world and make a new home for himself and his loved ones.
Spectacular World by RainyLiquid2020
200 parts Ongoing
Hope Lauren has read her share of comics. She's seen supers around her city and even been saved by some on occasion. And she always hoped that she'd be able to join them. With Jack, her grizzled older mentor with secrets that could shake the world, and Pantheon, a new team of heroes, Hope will have to fight against monumental odds to save Oleander City. In a world of action, comedy, tragedy, and adventure, there's plenty for a new hero to do. *Readers can expect a mostly adventure-themed superhero journey that will include a slice of life, action, and hopefully exciting world-building. It will also contain a slow-burn GL/Yuri plotline, which I'll eventually get to when I feel like it, I guess. This will be a very long story with many arcs* New chapter every Monday and Friday.
Veil of Beasts by swimmingmeow
19 parts Ongoing
In a single night, the once peaceful life was utterly shattered. The truth lurking beneath the calm surface was abruptly unveiled. Beneath human faces hid predatory gazes. Deception, betrayal, ambushes, battles, farewells... Life and death intertwined in brutal clashes; Good and evil locked in ceaseless confrontation; Right and wrong blurred in relentless strife. From that moment on, survival became a fragile balance- A world where the strong devoured the weak, Where one false step could lead to an endless abyss. How do we escape this labyrinth? How do we break free from the web of fate? Adrian Blackwood, an orphan, was transported at the age of six to a "parallel world," where he found himself embraced by a warm and loving family of five. At eighteen, Adrian stumbled upon a horrifying truth: this was no parallel world but a mysterious domain, and the family and friends around him were terrifying "beasts." Upon discovering this secret, Adrian barely escaped death. In his moment of despair, he unlocked a mysterious system-[Fortune]-a unique power that made him stronger the longer he survived. Thus began a ruthless game of survival, A battle between lambs and wolves.
𝐁𝐋𝐈𝐆𝐇𝐓𝐄𝐃 by lite-lemonade
15 parts Complete Mature
Since the dawn of time, humanity has been divided over various subjects. All of which are frankly, incredibly trivial. This being, but is not limited to race, religion, beauty, size, wealth, politics, and more. The heavy amounts of bickering and debating over these subjects, going as far as starting wars and in-fighting within families, even breaking some apart. This is further proven by the sudden appearance of enhanced individuals nicknamed "Blights," which single-handedly explains the general consensus about them. Hated and oppressed, Blights have had their backs against the wall for decades. Teenager Liam Wang must learn how to juggle both his civilian life and the life of his super-powered, crime-fighting persona "Narukami" and all that comes with it. Oh, and also a super-powered serial killer running around the city, murdering whoever they see fit. Yeah, he's probably screwed.
Soul by SAnastas
13 parts Ongoing Mature
"In a world ruled by power and tyranny, peace is a distant dream. You were once a child, innocent and new to life, yet someone ignited the flames of destruction, suffocating your breath and stealing away the purity of your air. All that remained were fleeting drops of water and the faintest hope that the fires would one day cease. Perhaps you were gifted, your powers beyond what was ever expected, but power isn't just strength-it's a threat. Years passed, and you grew to despise everyone and everything. In rage and vengeance, you found a twisted kind of salvation. Amidst the chaos, you found home with someone you've picked up while desperately trying to escape the chains of fate. And though agony shaped my path, I never wavered from my purpose. Through hell and blood, I built my name and wealth, offering others a chance for redemption, for lives once broken like my own. Now, after all this time, I've prepared to fulfill the final task of my life. Many will weep, blood will stain the earth, but certainly, they will pay for stealing my childhood. - Anastas
You may also like
Slide 1 of 9
Against the Divines cover
Excalibur {Complete} cover
We Were Stardust Once cover
Immortal in The Apocalypse cover
Aevum cover
Spectacular World cover
Veil of Beasts cover
𝐁𝐋𝐈𝐆𝐇𝐓𝐄𝐃 cover
Soul cover

Against the Divines

15 parts Ongoing Mature

In a reverse world where gods make contracts with mortals to fight for power and prestige, Bell , a fragile yet defiant boy with white hair and white eyes, finds himself enslaved and forced to fight for his survival. In this reversed society, where women dominate the battlefield and bed men are often reduced to househusband or slaves, Bell's fate seems sealed. But instead of succumbing, he rises to challenge the cruel expectations placed on him. As Bell faces terrifying beasts and powerful opponents, he uncovers hidden abilities that shock even the gods. In a world where humans are seen as inferior, and magic determines worth, Bell must unlock his potential to break free from the shackles of fate. Blending elements of dark fantasy, action, and reverse gender dynamics, this story follows Bell as he navigates a brutal society dominated by powerful female warriors, while uncovering secrets about his past that could change everything. The battle for survival, power, and freedom has only just begun, and Bell's rise will shake the very foundations of this world. His journey is one of defiance, determination, and a fate he never wanted-but one he must claim.

More details