Story cover for The Paramour (SPG) by Ymaru_
The Paramour (SPG)
Ymaru_
  • WpView
    Reads 1,732
  • WpVote
    Votes 12
  • WpPart
    Parts 4
  • WpView
    Reads 1,732
  • WpVote
    Votes 12
  • WpPart
    Parts 4
Ymaru_
Ongoing, First published Oct 07, 2014
Mature
charliecheatdoctorfictionfreakhiroymaruhusbandhusbandsrevengekabetkabitmaturenurseparamourrevengesci-fisciencespgwifeymaru
Genre: Science Fiction, Mystery/Thriller, Erotica

What is a PARAMOUR? 

   a lover of either sex, especially the illicit partner of a married person. 

Synonyms: mistress, inamorata, concubine.

-

What if you're working hard overseas then you'll find out that your wife is cheating on you? What will you do?

You'll hurt them? You'll file a case against them? or You will KILL them?

Yan ang mga bagay na unang papasok sa isip natin once na satin mangyari yan.

Pero hindi para kaya Charlie Ayala.

He remained silent and innocent to plan for his greatest revenge.

A revenge that they will never forget for the rest of their senseless lives.

He will let his wife feel what he feels when she cheated on him using her PARAMOUR.

-

Warning: Mature Content. Don't read this if you're not open minded. (SPG)

A story by: Hiro YMARU
All Rights Reserved © October 2016
All Rights Reserved
charliecheatdoctorfictionfreakhiroymaruhusbandhusbandsrevengekabetkabitmaturenurseparamourrevengesci-fisciencespgwifeymaru
Table of contents

4 parts

Sign up to add The Paramour (SPG) to your library and receive updates
or
Content Guidelines
You may also like
Love Series 1: A Love That Lies by olebnamra
15 parts Complete Mature
He says he loves me. He always makes me feel secured. He never let me doubt him. Because he is a man that respect and love me more than anything. But what if he cheats? What would you do? "A husband who cheated on his wife" ❗Matured Contents ❗
One Single Memory by Averysummer21
33 parts Complete Mature
Family, friends, schoolmates, colleagues. What if one day you'll wake up and none of these you remember? And what if one day you'll wake up and suddenly you had a ring on your finger? Zosia Lithuise Samaniego was once a very stubborn, childish and a bratty daughter, sister and a friend before a sudden vehicular accident that took her memories away and now turns her into someone nowhere near her old personality. How can she accept the fact that she's already married to a man she doesn't like? Priam Nicholson Esquivel, an outcast, brooding and intimidating Prosecutor who naturally shuns others is her told husband. With Zosia's empty memory, how is he going to make her remember him? Will that one single memory of him able to root on her mind? Or will the heart remembers what the mind chooses to forget? ESQUIVEL SERIES #4 This is written in Filipino. All rights reserved•2020
My Husband is a Liar (COMPLETED) by zacky_blue
36 parts Complete
"i want you to be with me forever untill our hair turns white and our face will have wrinkles"~ i said But.. If you'll leave, do it today. If you'll change, change for the better and if you talk, make sure you mean what you say. Because.. Cheating on a good person is like throwing away a DIAMOND and picking up a ROCK! Second chance ba ang solusyon sa lahat? O dapat nang pakawalan dahil masakit na? . . . Hindi lahat ng happy ending ay natatapos sa kasalan, that's just the beginning of their TRUE relationship na pang habang buhay.. What if your husband just USED you and cheated on you with your best friend. Can you still forgive him for the thirdtime? Bash nyo kung pangit Hehe. Peace... #1 newfriend #1 mrs #6 traitor #12 ex #12 cheater ( ^___________^ )
The Taste of HER COMEBACK (The Tears of the Martyr Wife) Book 2 by LuckyAvigail
36 parts Complete Mature
(COMPLETED) ( UNEDITED) Are you ready for her sweetest comeback? When they say never underestimate the Woman's power Elle mean it. And now she's here to proved na hindi lahat ng nasaktan hindi na kayang bumangon, she's here to proved the Girl's power, ang Asawang nasaktan, ang babaeng niloko at pinagsamantalahan at higit sa lahat ang nagmahan na ginawang basura lang ay nandito na, nagbabalik para patunayan sa lahat ang kayang gawain ng Isang taong nagmahal, sinayang, niloko, at sinaktan. Not your ideal love story, not your ideal story, not your ideal sequence of events, not your ideal list of characters, not your ideal main and when you read it read with understanding and heart, because this is not perfect like others story Read at your own Risk, lalo na't may mga bad words ito kung ayaw niyo dito wag niyo na ituloy pumasok para magbasa. BALALA:Nakakapaso, wag magpapadala baka masunog. sinayang,niloko at sinaktan. Start:7/29/2022 End:9/26/22 Book 1:The Tears of the Martyr Wife Book 2:The Taste of HER COMEBACK
SECRET CONFESSION: MGA BAYAW (Completed) by LeoIVIV
48 parts Complete
Mga kwento na ngayon niyo palang mababasa. Sekretong mabubunyag. Enjoy😃 R-18
Dirty Secret (COMPLETED) by Krixxie101
55 parts Complete Mature
WARNING: This story contains foul words, profanities, sexual content etc. ----- Moving into a place where you used to live with. The surrounding where you used to smile often and where your laughter's can only be heard. A place what they called paradise. Angel thought that maybe, just maybe it will gave her the comfort and warm feelings that she used to feel. She thought it will make her mind be at peace. With the calmness of green, with the fragrance of her sunflowers and with the thought that it was once her comfort zone. However, faith indeed has a playful twist. --- ⚠️ Do not report ⚠️ Before jumping into conclusions, mas mabuting basahin muna hanggang katapusan ang kwento. [UNEDITED, TYPOS AND ERRORS AHEAD] READ AT YOUR OWN RISK! [COVER DESIGN BY APPLE WP] Posted: March 21, 2021- November 14, 2021
CHAOS SERIES 1: MHAGENDELIA RAGUS (SPG 18+) by Xantalian
12 parts Complete Mature
She's so cold A heartless Known as Ms. Pader / wall He the king of mafia He always want to get what he want He's cold And he wants her Who's her? WARNING ; some scenes here are in Matured Content. PG-18 Rated SPG not allow to the those young ages, If you are not open minded just don't continue reading this or escape those bed scenes. PLEASE BE OPEN MINDED THANK YOU Titles and the whole story is originally own by; XANTALIAN and not for illegal copying including copy paste or any information storage without written permission from and author and writer out there. All characters, places and events have no existence whatsoever outside the imagination of the author, and have no related to anyone having the same name(s). They are not even distantly inspired by any individual known or unknown author and the incidents are merely invention. Expect for grammatical errors, wrong grammar and typos. Please follow me; WATTPAD: xantalian INSTAGRAM : xantalian1 Twitter : xantalian Facebook : XANTALIAN
The Promise of 30 by kalonfortunato
36 parts Complete Mature
Did you ever had a friend who promised marriage to you? I do. I have Six. He was my unofficial guy, an inspiration I never expected to come, but he did anyway. But I knew, I know, we were more than just that. I felt it. We both felt it. We are meant to be together for the rest of our lives. Yet no matter how much we felt and knew that, we chose to ignore. We only left a promise to each other that only kids do. "'Pag wala pa akong asawa kapag 30 na ako, tapos wala ka pa ring asawa 'non, papakasalan kita." Ngumiti ako sa sinabi mo. Ngiting kahit kailan, hindi mo malilimutan. Ngiting sa iyo ko lang binibigay at ikaw lang ang makakakita. And that time, we were engaged on the side. We became each other's love that's about to be kept to nourish for the future. That is the promise of 30 I will never regret that I made. Date started: February 17, 2023 Date ended: March 11, 2023 MOST IMPRESSIVE RANKINGS #1 in #FALLBACK #1 in #ENGAGED #3 in #CHEATING #16 in #ENGAGEMENT #17 in #PROMISE #19 in #WEDDING #25 in #FOOL #50 in #WEDDINGPLANNER #190 in #FIANCE
You may also like
Slide 1 of 8
Love Series 1: A Love That Lies cover
One Single Memory cover
My Husband is a Liar (COMPLETED) cover
The Taste of HER COMEBACK (The Tears of the Martyr Wife) Book 2 cover
SECRET CONFESSION: MGA BAYAW (Completed) cover
Dirty Secret (COMPLETED) cover
CHAOS SERIES 1: MHAGENDELIA RAGUS (SPG 18+) cover
The Promise of 30 cover

Love Series 1: A Love That Lies

15 parts Complete Mature

He says he loves me. He always makes me feel secured. He never let me doubt him. Because he is a man that respect and love me more than anything. But what if he cheats? What would you do? "A husband who cheated on his wife" ❗Matured Contents ❗

More details