Story cover for The Paramour (SPG) by Ymaru_
The Paramour (SPG)
Ymaru_
  • WpView
    OKUNANLAR 1,751
  • WpVote
    Oylar 13
  • WpPart
    Bölümler 4
  • WpView
    OKUNANLAR 1,751
  • WpVote
    Oylar 13
  • WpPart
    Bölümler 4
Ymaru_
Devam ediyor, İlk yayınlanma Eki 07, 2014
Yetişkin
charliecheatdoctorfictionfreakhiroymaruhusbandhusbandsrevengekabetkabitmaturenurseparamourrevengesci-fisciencespgwifeymaru
Genre: Science Fiction, Mystery/Thriller, Erotica

What is a PARAMOUR? 

   a lover of either sex, especially the illicit partner of a married person. 

Synonyms: mistress, inamorata, concubine.

-

What if you're working hard overseas then you'll find out that your wife is cheating on you? What will you do?

You'll hurt them? You'll file a case against them? or You will KILL them?

Yan ang mga bagay na unang papasok sa isip natin once na satin mangyari yan.

Pero hindi para kaya Charlie Ayala.

He remained silent and innocent to plan for his greatest revenge.

A revenge that they will never forget for the rest of their senseless lives.

He will let his wife feel what he feels when she cheated on him using her PARAMOUR.

-

Warning: Mature Content. Don't read this if you're not open minded. (SPG)

A story by: Hiro YMARU
All Rights Reserved © October 2016
Tüm hakları saklıdır
charliecheatdoctorfictionfreakhiroymaruhusbandhusbandsrevengekabetkabitmaturenurseparamourrevengesci-fisciencespgwifeymaru
İçindekiler

4 bölüm

Eklemek için kaydolun The Paramour (SPG) kütüphanenize ekleyin ve güncellemeleri alın
veya
İçerik Rehberi
Ayrıca sevebilecekleriniz
Canterlot_City tarafından yazılmış Love in a Rush II (LR 2) adlı hikaye
65 bölüm Tamamlanmış Hikaye
#couple #lovestory #jealousy #career #homemaker #kids #romance #marriage #choices Disclaimer: This story should not be mistaken for a fairy tale. This is not appropriate for kids. THIS IS SPG | STEAMY |RAUNCHY
Averysummer21 tarafından yazılmış One Single Memory adlı hikaye
33 bölüm Tamamlanmış Hikaye Yetişkin
Family, friends, schoolmates, colleagues. What if one day you'll wake up and none of these you remember? And what if one day you'll wake up and suddenly you had a ring on your finger? Zosia Lithuise Samaniego was once a very stubborn, childish and a bratty daughter, sister and a friend before a sudden vehicular accident that took her memories away and now turns her into someone nowhere near her old personality. How can she accept the fact that she's already married to a man she doesn't like? Priam Nicholson Esquivel, an outcast, brooding and intimidating Prosecutor who naturally shuns others is her told husband. With Zosia's empty memory, how is he going to make her remember him? Will that one single memory of him able to root on her mind? Or will the heart remembers what the mind chooses to forget? ESQUIVEL SERIES #4 This is written in Filipino. All rights reserved•2020
EagOlfBlack tarafından yazılmış Billionaire Series#05: His Bad Intention adlı hikaye
6 bölüm Devam ediyor Yetişkin
On-going Billionaire Series$05: Kaiser Railey Schmidt It was planned, everything is according to what he wanted. Love is not part of his dictionary and Revenge is only priority. "You're my most precious instrument so, you must be careful" "Wag kang mag-alala akong bahala sa puso mo" "Are you crazy, Miss Nurse?. I don't love you and I didn't. Even once..." "Itigil ang kasal!" "FUCK!. MARRY ME! DAMN, YOU CAN'T SAY NO!. AKIN KA LANG DAPAT!" "HINDI KA SASAMA?..." "ITATANAN KITA, KIDNAP KUNG KIDNAP, PUTCHA! BAKIT AYAW MO?" "HINDI KA NA MAKAKATAKAS. YES, I HAD IT BUT STILL, I HAVE IT. I HAVE A BAD INTENTIONS IN MY MIND THAT'S WHY, YOU NEED TO FOLLOW ME OR ELSE YOU'LL REGRET IT... DO. YOU. UNDERSTAND. MY PRECIOUS?"
LuckyAvigail tarafından yazılmış The Taste of HER COMEBACK (The Tears of the Martyr Wife) Book 2 adlı hikaye
36 bölüm Tamamlanmış Hikaye Yetişkin
(COMPLETED) ( UNEDITED) Are you ready for her sweetest comeback? When they say never underestimate the Woman's power Elle mean it. And now she's here to proved na hindi lahat ng nasaktan hindi na kayang bumangon, she's here to proved the Girl's power, ang Asawang nasaktan, ang babaeng niloko at pinagsamantalahan at higit sa lahat ang nagmahan na ginawang basura lang ay nandito na, nagbabalik para patunayan sa lahat ang kayang gawain ng Isang taong nagmahal, sinayang, niloko, at sinaktan. Not your ideal love story, not your ideal story, not your ideal sequence of events, not your ideal list of characters, not your ideal main and when you read it read with understanding and heart, because this is not perfect like others story Read at your own Risk, lalo na't may mga bad words ito kung ayaw niyo dito wag niyo na ituloy pumasok para magbasa. BALALA:Nakakapaso, wag magpapadala baka masunog. sinayang,niloko at sinaktan. Start:7/29/2022 End:9/26/22 Book 1:The Tears of the Martyr Wife Book 2:The Taste of HER COMEBACK
zacky_blue tarafından yazılmış My Husband is a Liar (COMPLETED) adlı hikaye
36 bölüm Tamamlanmış Hikaye
"i want you to be with me forever untill our hair turns white and our face will have wrinkles"~ i said But.. If you'll leave, do it today. If you'll change, change for the better and if you talk, make sure you mean what you say. Because.. Cheating on a good person is like throwing away a DIAMOND and picking up a ROCK! Second chance ba ang solusyon sa lahat? O dapat nang pakawalan dahil masakit na? . . . Hindi lahat ng happy ending ay natatapos sa kasalan, that's just the beginning of their TRUE relationship na pang habang buhay.. What if your husband just USED you and cheated on you with your best friend. Can you still forgive him for the thirdtime? Bash nyo kung pangit Hehe. Peace... #1 newfriend #1 mrs #6 traitor #12 ex #12 cheater ( ^___________^ )
Krixxie101 tarafından yazılmış Dirty Secret (COMPLETED) adlı hikaye
55 bölüm Tamamlanmış Hikaye Yetişkin
WARNING: This story contains foul words, profanities, sexual content etc. ----- Moving into a place where you used to live with. The surrounding where you used to smile often and where your laughter's can only be heard. A place what they called paradise. Angel thought that maybe, just maybe it will gave her the comfort and warm feelings that she used to feel. She thought it will make her mind be at peace. With the calmness of green, with the fragrance of her sunflowers and with the thought that it was once her comfort zone. However, faith indeed has a playful twist. --- ⚠️ Do not report ⚠️ Before jumping into conclusions, mas mabuting basahin muna hanggang katapusan ang kwento. [UNEDITED, TYPOS AND ERRORS AHEAD] READ AT YOUR OWN RISK! [COVER DESIGN BY APPLE WP] Posted: March 21, 2021- November 14, 2021
PrincessThirteen00 tarafından yazılmış The Cheated (Cheat Duology) adlı hikaye
36 bölüm Tamamlanmış Hikaye Yetişkin
After discovering his ex-girlfriend's betrayal, Chase struggles to move on as their shared memories keep haunting him. *** Hardworking Chase Dimaguiba has every trait a woman could ask for--faithful, loving, supportive, and a real husband material. He intends to create a perfect and stable future with his long-time girlfriend, Cinni Romero--the girl every man desires. For him, Cinni is the sun, showering brightness and giving life wherever she goes, while he is the pitch-black sky surrounding and watching the moon in silence. And for him, polar opposites are the perfect match--sitting at the end of the scales that balance each other out. He believes they are meant to be together . . . forever. Chase loves Cinni unconditionally, and she does, too. But when he catches her in an illicit affair, breaking their relationship of seven years, can Chase forgive and forget when both the sweet and painful memories keep on resurfacing? Or is it too late to fix the heart and trust of the cheated? This story is written in Taglish. *** CHEAT DUOLOGY THE CHEATED | THE CHEATER Original story by Jo Elle A collaboration between PrincessThirteen00 and thexwhys. *** Copyright © 2022, PrincessThirteen00. All rights reserved. Reproduction or transmission in whole or in part in any form or medium without express written permission by the author is prohibited. PLAGIARISM IS A CRIME.
S3CR3TLY tarafından yazılmış Lustful Desire #1: Aiken Ventura adlı hikaye
9 bölüm Tamamlanmış Hikaye Yetişkin
Warning: Mature Content | SPG | Lust Series#1: Aiken Ventura Synopsis: He always fucking a woman and after that wala na siyang pakialam. Sa dami na ng naikamang babae ni Aiken ay wala man lang siyang naalalang pangalan. He's beast in business and specially in bed. He never fall in love but the girl that wearing a revealing dress caught his attention. She so fucking attractive. At hindi niya inaasahan na makakatalik pa niya ito. Sa dami ng babaeng nakatalik niya ay kakaiba ito at gusto niya pang maulit ang nangyari sa kanila. Ngunit paggising niya ay wala na siyang maalala. He only remember is a girl na wala na sa tabi niya at iniwan siya pagkatapos nilang magtalik. Kaya niya bang gantihan ang isang babaeng matagal niya na palang kilala at ngayon ay inaasam niya ng namakuha? Special Chapter is available on DREAME Read at your own risk. November-January 6 2021
Chelsea_13 tarafından yazılmış VINCENT (Book 2 of 2) ↠ Amor Aeternus | (PUBLISHED UNDER CLOAK-POPFICTION) adlı hikaye
83 bölüm Tamamlanmış Hikaye
↠ Status: COMPLETED ↠ Genre: Gen Fic/ Mystery / Sci Fi *** ↠ Amor aeternus : Love Forever *** "I'm just tired Savannah." Tinanggal niya ang kamay ko na nakapulupot sa kaniya. "I'm sick and tired of us." Wala niya akong emosyong pinagtitigan. Kung may awa man o panghihinayang sa mawawala sa amin na dapat kong makita sa mga mata niya ay magaling niya itong naitago mula sa akin. "Abort that thing if you want. I don't give a damn, that's not mine to begin with," aniya at napailing sa akin. "I loved you. But I'm done doing it, Savannah. I am done loving you." I breathed deeply and looked around the room, trying to remember the moment...trying to remember the indifference of my brother towards me and trying to remember the pain of what love has brought me. "You know Reed? Sana hindi na kita minahal. Sana hindi ko na isinuko ang sarili ko, ang puso ko...ang kaluluwa ko sa'yo. When I let myself love you again, I gave you the power to destroy me...and you know what? 'Yun mismo ang ginawa mo. But godd a mn it," sabi ko sa kaniya at napapailing na lamang. Isang malaking biro talaga ang nangyayari sa amin ngayon. "Biruin mo? when you cheated on me, when you hurt me and I was fucking destroyed, ano nga ulit ang ginawa ko? Pinatawad lang kita. Ang martyr ano? Ha! I was even the one who crawled back to you. Ako pa ang nagsusumiksik diyan sa puso mo. Pero sige na nga, kung ayaw mo na, sige. Let's just end this. Napapagod na rin naman ako." Hindi na talaga ako muling magmamahal ng ganito. Ipinapangako kong hinding-hindi na ako magmamahal ng ganito o magtitiwala kung kanino man. Trusting and loving people will only lead me back to this. At hindi ko na makakayanan pa siguro kung uulit sa akin ang ganito. "Ang hirap mong mahalin, Reed. Nakakapagod." ↠ © Copyright Chelsea_13, 2015. All rights reserved. ↠ Book 2 of 2
ssearyxz tarafından yazılmış Heartless Beat adlı hikaye
55 bölüm Tamamlanmış Hikaye Yetişkin
Miseries # 2 HEARTLESS BEAT: HOME OF OLD HEARTS (GXG STORY: UNEDITED) "You should stop, Kival. I'm not your wife, you're delusional." Sabi ko at tumayo. Inayos ko ang uniform ko dahil nalukot pero hahawakan ko na sana ang necktie ng uniform ko nang bigla niya iyon hablutin nang dahan-dahan. "You are my wife, Yuryne Satana Narvaez-Yves. Ipagtabuyan mo ako, sige lang. Magalit ka sa akin, sige lang din. Mairita ka, go on. Pero don't ever deny that you are mine- you are married to me." She was damn serious for saying those words. "I'm not your wife anymore, kaya stop saying and stop bragging that you owned me kasi hindi na." Tinapatan ko ang titig niya. "You still love me." Mas nataas siya sa'kin dahilan kung bakit kailangan ko pang tumingala nang bahagya para makita siya. "..and you never love me." Ganti ko. Start: January 2025 End: October 2025
Ayrıca sevebilecekleriniz
Slide 1 of 10
Love in a Rush II (LR 2) cover
One Single Memory cover
Billionaire Series#05: His Bad Intention cover
The Taste of HER COMEBACK (The Tears of the Martyr Wife) Book 2 cover
My Husband is a Liar (COMPLETED) cover
Dirty Secret (COMPLETED) cover
The Cheated (Cheat Duology) cover
Lustful Desire #1: Aiken Ventura cover
VINCENT (Book 2 of 2) ↠ Amor Aeternus | (PUBLISHED UNDER CLOAK-POPFICTION) cover
Heartless Beat cover

Love in a Rush II (LR 2)

65 bölüm Tamamlanmış Hikaye

#couple #lovestory #jealousy #career #homemaker #kids #romance #marriage #choices Disclaimer: This story should not be mistaken for a fairy tale. This is not appropriate for kids. THIS IS SPG | STEAMY |RAUNCHY

Daha fazla bilgi