Queen Witches of Aradia
asphyyxiaa
  • MGA BUMASA 919
  • Mga Boto 232
  • Mga Parte 9
  • Oras 32m
  • MGA BUMASA 919
  • Mga Boto 232
  • Mga Parte 9
  • Oras 32m
asphyyxiaa
Ongoing, Unang na-publish Oct 31, 2020
actionadventurebadassbravecomedydarkfantasydramaepicfantasyfightingfriendshiphothumorlovemagicmysteryparanormalparanormalfantasypossessivepowerromancesupernaturalsuspensethrillerwitcheswizards
"I'm the beauty and I'm the beast. I am the evil and I am the priest".

*****

Kaylin Luna D'vincenzo is scarred from the moment she finds out the dark truth. 

-The very reason as to why her parents died.-

Things start spicing up when she finds herself in a tough spot, struggling to choose between two. 

Enrique de la 'Costa, her smokin' hot boss --who treats her as a second option-- but warms up at her touch. 
And Luis Williams, the guy who brings her alive. She can't help but feel irresistibly drawn towards them. ♡ 

Who will she pick?
All Rights Reserved
actionadventurebadassbravecomedydarkfantasydramaepicfantasyfightingfriendshiphothumorlovemagicmysteryparanormalparanormalfantasypossessivepowerromancesupernaturalsuspensethrillerwitcheswizards
Table of contents

9 mga parte

Sign up to add Queen Witches of Aradia to your library and receive updates
o
#393epicfantasy
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
Alphas Mrs. Right ni The_Nasty_Gal
30 Parte Kumpleto Mature
When a werewolf prince comes of age the royal family must hold a ceremony at which 30 girls will go to the castle and live there until he choose's one of them to be queen and Luna. Ava your everyday sarcastic , book loving, commoner is chosen to go to the castle and fight for prince Masons attention. Although she doesn't want the crown or the prince. She just wants the paycheck that come with being chosen, to help her family. Little does she know she's Masons true mate. She speaks her mind, ignores the prince, and a royal knight won't stop looking at her. What could go wrong.
Beautiful Beast ni lucyanneholland
35 Parte Kumpleto
My name is Kalista. They call me the beast. Kalista has been cursed by a powerful sorceress and is now a prisoner in her own palace. As petals fall from an enchanted rose, her fate and the sorceress's victory draw nearer. But Kalista refuses to be defeated so easily and uses her own magic to push against the bindings. Yet what if it is not enough and the only way the curse might be shattered is through the help of another? When Arawn crosses into the beast's domain, he has one motive: revenge for his brother's death. But as he draws nearer to the beast and is surrounded by invisible servants, magical banquets, and an enchanted forest, he realizes that this beast is much more complex and much more human than he first thought. As their paths intertwine, Kalista must risk opening her heart to another, while Arawn must learn to see past his hate and prejudice. Together, they struggle against spells, wolves, and time itself to break the curse. If they fail, Kalista will fall asleep and will never again wake.
Hidden Gem - Beasts of Beauty Series - Book 4 ni CalamitousLove
22 Parte Ongoing Mature
Malachite is content with the life that was laid out for her - or so she thinks. She has a family that loves her, a man who treats her like a goddess, and is in the running to be the next leader of her isolated community. She continues to do what is expected of her, trying to be happy with the life she has as she prepares for the future. What happens when the future shows up sooner than anticipated? Mysterious monsters and overwhelming emotions are thrown into the mix and Malachite must decide if the path she is on is the path she truly wants to follow. Her family wants war and she is left with a choice. She knows that no matter what she picks, someone will get hurt. - - - Beasts of Beauty Series: Book 1 - Luna Book 2 - Amended Dreams Book 3 - I Will Wait Book 4 - Hidden Gem The books in this series are stand-alone; they can be read out of order or skipped completely without consequence. - - - Sporadic Updates
Bloody Roses ni JadeLorynn
4 Mga Parte Ongoing Mature
𝘈 𝘭𝘪𝘧𝘦 𝘢𝘴 𝘢 𝘮𝘦𝘨𝘢 𝘳𝘪𝘤𝘩 𝘰𝘶𝘵𝘤𝘢𝘴𝘵 𝘸𝘪𝘵𝘩 𝘻𝘦𝘳𝘰 𝘴𝘰𝘤𝘪𝘢𝘭 𝘴𝘬𝘪𝘭𝘭𝘴 𝘢𝘯𝘥 𝘢 𝘯𝘰𝘯𝘤𝘩𝘢𝘭𝘢𝘯𝘵 𝘢𝘵𝘵𝘪𝘵𝘶𝘥𝘦 VS. 𝘭𝘪𝘧𝘦 𝘢𝘴 𝘢 𝘣𝘢𝘥 𝘢𝘴𝘴 wolf shifter, vampire 𝘩𝘺𝘣𝘳𝘪𝘥 𝘱𝘳𝘪𝘯𝘤𝘦𝘴𝘴 𝘥𝘦𝘴𝘵𝘪𝘯𝘦𝘥 𝘵𝘰 𝘴𝘢𝘷𝘦 𝘵𝘩𝘦 𝘶𝘯𝘥𝘦𝘳𝘸𝘰𝘳𝘭𝘥 𝘧𝘳𝘰𝘮 𝘤𝘦𝘳𝘵𝘢𝘪𝘯 𝘦𝘷𝘪𝘭... 𝘞𝘩𝘪𝘤𝘩 𝘰𝘯𝘦 𝘸𝘰𝘶𝘭𝘥 𝘺𝘰𝘶 𝘤𝘩𝘰𝘰𝘴𝘦? 𝘔𝘦? 𝘐 𝘥𝘰𝘯'𝘵 𝘨𝘦𝘵 𝘵𝘩𝘢𝘵 𝘤𝘩𝘰𝘪𝘤𝘦. 𝘐 𝘸𝘢𝘴 𝘯𝘦𝘷𝘦𝘳 𝘩𝘶𝘮𝘢𝘯 𝘢𝘯𝘥 𝘵𝘩𝘢𝘵 𝘭𝘪𝘧𝘦 𝘥𝘦𝘤𝘪𝘮𝘢𝘵𝘦𝘥 𝘵𝘩𝘦 𝘴𝘦𝘤𝘰𝘯𝘥 𝘪 𝘸𝘢𝘴 𝘱𝘭𝘶𝘯𝘨𝘦𝘥 𝘣𝘢𝘤𝘬 𝘪𝘯𝘵𝘰 𝘵𝘩𝘦 𝘸𝘰𝘳𝘭𝘥 𝘪 𝘩𝘢𝘥 𝘭𝘰𝘯𝘨 𝘧𝘰𝘳𝘨𝘰𝘵𝘵𝘦𝘯.. Kala dean aka Princess Kali-Ma Vusanovich has officially had her world turned upside down as she has a run in with two peculiar beings with dangerous auras that she finds vaguely familiar but cant quite place. Now she has to leave the life shes known for the past 17 years. She must travel across state lines to get answers about her past lives with a woman whose hold on her heart resembles a vice grip and a man who sends lightening through the nerves beneath her skin at every touch. She encounters danger at almost every turn and its up to her to save everyone she loves. Will she succumb to the darkness that threatens to drag her and the entire world into chaos. Or will she rise above it and claim her birthright as the most powerful being the world has ever known?
His Demonic Obsession: Demonic Series (Book 2)✓ ni KrazySkittz
62 Parte Kumpleto Mature
(Warning 18+) Years have now passed and Elijah's dark secrets are now revealed and Luna is holding on to her sanity. Can she still find it in her heart to love Elijah after everything he's put her through? Or will she try to escape from his clutches with the help of Felix along the way? Old memories come and resurface causing more complicated relationships to form between Luna and the others. However, after everything she has lost and been through so far, is it too late to forgive Elijah who caused all this pain to her? Or will Elijah's love be enough to heal Luna's painful scars? "Sins continue to grow and my heart can't stop what it desires. He was the darkness that always followed me, that always tainted me. And I was the forbidden fruit that he craved for." ©️COPYRIGHT 2019 T.M. Luna All rights reserved. 🥇1st Place Fantasy Winner Gothica Award
Strange Girl( Editing ) ni DrakeSlayer
15 Parte Kumpleto
#fantasy #Romance #paranormal ____________ The strangest person for you is the one you love. ± ± ± ± ± ± ± ± ± ± ± ± Kaci was a beautiful girl. But her beauty make her in great danger. But she doesn't care. She learned martial art to defend herself . Men even wizards,werewolves,vampires are trying to kidnap her. She doesn't believe in love. She thought that men were trying to get her because she is beautiful. But she hates man a little that because of her past telling her ugly. She want to break every men heart who trying to get near her. But there is a sexy handsome man who came to her life. His name is 'Blake'. He love Kaci very deeply. He tries everything to win her heart. will Blake be able to win Kaci's heart? This story goes with POV: ______________ ~edited by @Bo-Sydney~ #1 in the amazing monthly awards
An Alpha's Kiss | ✔️ ni Dark-Shadow
45 Parte Kumpleto
(Rooming with Royals Sequel) He's the prince of werewolves. She's the princess of demons and witches. Silently falling for her childhood best friend, Aya doubts the chance of them ever becoming together and denies the feelings she has for him. "You're a werewolf, Jace! I will be a temporary substitute till your mate comes." My chest heaved up and down, struck by the harsh reality. Mates are sacred to werewolves. The love that mates have for each other is unlike all beings. The love Jace has for me is nothing compared to the love he will have for his mate. "Aya -" "No Jace. You love me but you'll love your mate more. You'll continue your life normally, but I'm the one who's going to be left heartbroken. Someday, you will find her and throw me away like I was nothing." My lips quivered as I chocked the words out. "I know what I want Aya. With or without a mate, I want you. "
Crimson Lust ni lunettemoonshine
23 Parte Kumpleto
*𝐌𝐚𝐭𝐮𝐫𝐞 𝐂𝐨𝐧𝐭𝐞𝐧𝐭* 🌶 {COMPLETED} Princess Luna is caught in a horrible storm that leaves her stranded, until she is found by the Vampyr Prince of Nightshades, Prince Jace. Because of how delicious her blood smells, he imprisons her into a tower so that he can feed off of her. As it seems, the Palace of Nightshades needs a King, and the Vampyr Prince is next in line, but only if he marries and has a Queen by his side. The imprisoned Luna is his key to becoming King, and so he forces her to marry him in return for her life - and for a bigger title. Little do they both know, Luna cannot control herself in his presence despite what a monster he is, while he has urges and desires for more than just her blood. Everyone has a soft spot in them, no matter how long they choose to deny it. - note: i hope you enjoy my first ever little Wattpad novel, I had fun with it ♡
Hiding From Light: A Beauty and the Beast Genderbend ni Arieltoria
37 Parte Kumpleto
14 in fairytaleretelling 10/23/22 Princess Luna of Yaquir angered the wrong person. Now she's doomed to be a beast, as ugly on the outside as she is within, unless she can find someone to love her. At first, with her curse, she thought of only one thing. Ashton. The one thing she wanted, but never got. It made her bitter. And now, she's paying the price. /// Brandon has never been like "the others." They turn to the latest forms of technology and entertainment, determined to make the most of every game and fad to come into their hands. All he really wants is a safe haven to turn the pages of a book, and the ability to lose himself in a world of fiction and others' problems. So when he finds out that libraries all over Yaquir are closing down due to decreased usage and an overabundance of E-books, and that his might be next, he decides to take matters into his own hands. He never dreamed he'd actually end up at a castle instead. Just as he never dreamed he'd become hopelessly stuck there either. This is a Beauty and the Beast genderbend, and the third book in the Light series. As with all of my books, it can be read as a standalone. It's rated PG-13 for language and violence. Updates will be every Saturday starting July 9
Claimed by Him ni Werepanther
56 Mga Parte Kumpleto
Comtesse de Luna Mystique whose family trails back far into ancient myths and great gods, comes across a downturn in her life. The death of her brother. However his death was an unusual one as her brother's murder came not from human hands but of claws and sharp fangs. One must never go out on a full moon and that is exactly what she does seeking vengeance against the monster who took away her brother. What she doesn't expect is to actually find the beast let alone be slightly admired by the foul, cruel monster who suddenly becomes possessive of her life. What's worse than being lusted for by a wolf? Being attracted to another that's related to him. Samson Nightly. With Luna being favoured by the wolves it concerns her friends who of another kind of mythical being that have kept themselves secret for centuries on end, have been hunting down this beast, this monstrosity! They discover that who they've been hunting down for years is stalking Luna. With that they have had to admit secrets to introduce a much darker world than what it seems. Luna has many other troubles facing her as she starts to discover more about her capabilities and more of her emotions when it comes to wolves and fellow mortals with their own dark secrets. All in all Luna trusts Sam and whatever happens on a full moon night stays on a full moon night. (To be re-written)
Magugustuhan mo rin ang
Slide 1 of 10
Alphas Mrs. Right cover
Beautiful Beast cover
Hidden Gem - Beasts of Beauty Series - Book 4 cover
Bloody Roses cover
His Demonic Obsession: Demonic Series (Book 2)✓ cover
Strange Girl( Editing ) cover
An Alpha's Kiss | ✔️ cover
Crimson Lust cover
Hiding From Light: A Beauty and the Beast Genderbend cover
Claimed by Him cover

Alphas Mrs. Right

30 Parte Kumpleto Mature

When a werewolf prince comes of age the royal family must hold a ceremony at which 30 girls will go to the castle and live there until he choose's one of them to be queen and Luna. Ava your everyday sarcastic , book loving, commoner is chosen to go to the castle and fight for prince Masons attention. Although she doesn't want the crown or the prince. She just wants the paycheck that come with being chosen, to help her family. Little does she know she's Masons true mate. She speaks her mind, ignores the prince, and a royal knight won't stop looking at her. What could go wrong.

Karagdagang detalye