Story cover for The Legend Of Zelda - Tale of a Dark Hero by Flooyd
The Legend Of Zelda - Tale of a Dark Hero
Flooyd
  • WpView
    Reads 1,726
  • WpVote
    Votes 39
  • WpPart
    Parts 19
  • WpHistory
    Time 1h 50m
  • WpView
    Reads 1,726
  • WpVote
    Votes 39
  • WpPart
    Parts 19
  • WpHistory
    Time 1h 50m
Flooyd
Ongoing, First published Nov 05, 2020
adventurebotwbreathbreathofthewildcalamitycastledivinefanficfightganonherohyrulekinglegendlegendofzeldalinklozmipharevalisheikahsidonswordtlozzeldazelink
One day, Link explores what seemed to be the hideout of someone linked to Ganon the Calamity. Inside, a little boy sits on the floor, an empty gaze straying towards Link. Who is he ? What is he doing in this abandoned place ? Link's questions stay unanswered. He decides to bring the boy back with him to the castle, but this will have more consequences than what he could have imagined.
All Rights Reserved
adventurebotwbreathbreathofthewildcalamitycastledivinefanficfightganonherohyrulekinglegendlegendofzeldalinklozmipharevalisheikahsidonswordtlozzeldazelink
Table of contents

19 parts

Sign up to add The Legend Of Zelda - Tale of a Dark Hero to your library and receive updates
or
#206botw
Content Guidelines
You may also like
Legend of Zelda, The Kingdom's Tears by GothicMoonlight
23 parts Complete
A few years after the battle with the Calamity, Hyrule continues its restoration with the aid of the surviving royal family; when an mysterious fog arises underground, Link, Kate, and Zelda go in to investigate, only to find and awaken the real Ganondorf; Ganondorf's attack sends Zelda away, a Master Sword breaks, Link loses his arm, and Hyrule Castle begins floating skyward; Link, Kate, and Sheik must travel around Hyrule once more, even going skyward to find and save Zelda before it's too late.
Hyrule Champions (sidlink) by howdyhowl
18 parts Complete
!!! THIS IS NOT THE SEQUEL TO THE REWRITE OF HIS CHAMPION, THIS IS THE ORIGINAL SEQUEL !!! This is the sequel to His Champion. Link has just defeated Calamity Ganon, and saved his best friend, Zelda. Now, they must decide what they should do next to revert Hyrule back to its former glory. I do not own any of these character as they all belong to Nintendo. I do not own any of the art.
The Princess and Her Knight - A Breath of the Wild FanFiction by nightowl2525
59 parts Complete Mature
Before the Great Calamity, Zelda and Link travel amongst Hyrule together. They must learn to tolerate each other on their journey. Zelda, having barely been able to leave the castle much before him, discovered her sense of adventure when she went out with Link. Is it possible that the two of them harbored a secret admiration for each other than ran deeper than friendship? Or would Link maintain his silence and not speak to the princess at all? This story flashes back from before and after the Great Calamity. What happens after Link defeats Calamity Ganon? This story is very long, but if I do say so myself, I think it's worth it! There will be a sequel. Contains spoilers. I DO NOT OWN THESE CHARACTERS OR ANYTHING/MONOLOGUE THAT HAPPENED IN THE GAME, it belongs to Nintendo. Some parts of the story however did not occur in the game. I hope you enjoy! Contains violence and some implications of sex. Cover art to Eorinamo, https://www.pinterest.com/amp/pin/541769030169781166/
Fabricated Fate - A Breath of the Wild Fanfiction by CapricornSiren
32 parts Complete
A young girl named Thalia is found by Princess Zelda and her knight at the time, Link. Taken into the castle, Thalia has a choice to become a knight herself or an occupation that will help benefit the castle. One day, Princess Zelda gets kidnapped by Ganondorf as Link couldn't stop him. Feeling like it was his fault, Link seeks out to rescue the princess, but he cannot do it alone. **This is a Link x Zelda story **Contains OCs
Remember When...(Link x Reader) by Maple_The_Awesome
61 parts Complete
A hundred years ago, a group of Champions had planned and trained to fight Calamity Ganon. None of them could have predicted what actually ended up happening next: a betrayal from within leading to the destruction of Hyrule. After all those years, Link had awoken with no memory, feeling completely lost in this still healing world. He wouldn't have ever been able to find his way if it wasn't for you, a fellow traveler who has taken it upon herself to aid Hyrule's hero in his quest.
Zora's Domain - The Knight And The Prince by SH27BG3
28 parts Complete Mature
A story about an injured Hylian Knight travelling with a Zoran Prince, their travels are filled with jealousy, sadness, dangerous fights and more. They meet various people on their travels, some that cause arguments, others who help and heal.
The Heroes' Rebirth | BOTW Sequel/Zelink (The Legend of Zelda) by HeroOfRhythm
30 parts Complete
~This is a COMPLETED fan-made sequel to Breath of the Wild and Zelink fanfic~ It has been six months after the defeat of Calamity Ganon. Peace and rebirth are beginning to come upon the land of Hyrule once again. Zelda is deep in planning of the repair of Hyrule Castle and Hyrule Castle Town, and Link is busy with the cleansing of the lands from monsters. The two have had almost no time together after their fight with Ganon. As events begin to settle down, and Zelda and Link finally spend time together, Master Kanto, the new leader of the Yiga Clan, hatches a plan to end the "Hero" once and for all and raise darkness and malice over the land again. Much love to you all! Cover art by @ebiebieshrimp -The Legend of Zelda is owned by Nintendo- #1 in loz #1 in hyrule #2 in zelink #2 in botw #2 in zelda
The Silent Princess - A Breath Of The Wild Fanfiction by Ellieaziya
62 parts Complete
Time has passed. Hyrule is getting rebuilt. Zelda on the other hand is not quite sure what to do. She is no longer a princess, She's a queen with responsibilities. A dark force is looming. Old friends are getting rediscovered but that boy. That man. Link. There's an unfinished story with him. This is my take on the universe. There will be new characters that aren't canon. There will be a few POV swaps but let's see if I can make this a cohesive story.
The Heroes' Rebirth - REVISITED | BOTW Sequel/Zelink (The Legend of Zelda) by HeroOfRhythm
27 parts Complete
~Having returned after two years, I decided to edit The Heroes' Rebirth. I changed (hopefully) all of the spelling errors, fixed the grammar and changed some of the sequences of events. I added some extra scenes as well. Hope you enjoy the revised version :) HR It has been six months after the defeat of Calamity Ganon. Peace and rebirth are beginning to come upon the land of Hyrule once again. Zelda is deep in planning of the repair of Hyrule Castle and Hyrule Castle Town, and Link is busy with the cleansing of the lands from monsters. The two have had almost no time together after their fight with Ganon. As events begin to settle down, and Zelda and Link finally spend time together, Master Kanto, the new leader of the Yiga Clan, hatches a plan to end the "Hero" once and for all and raise darkness and malice over the land Cover art by @ebiebieshrimp -The Legend of Zelda is owned by Nintendo-
You may also like
Slide 1 of 9
Legend of Zelda, The Kingdom's Tears cover
Hyrule Champions (sidlink) cover
The Princess and Her Knight - A Breath of the Wild FanFiction cover
Fabricated Fate - A Breath of the Wild Fanfiction cover
Remember When...(Link x Reader) cover
Zora's Domain - The Knight And The Prince cover
The Heroes' Rebirth | BOTW Sequel/Zelink (The Legend of Zelda) cover
The Silent Princess - A Breath Of The Wild Fanfiction cover
The Heroes' Rebirth - REVISITED | BOTW Sequel/Zelink (The Legend of Zelda) cover

Legend of Zelda, The Kingdom's Tears

23 parts Complete

A few years after the battle with the Calamity, Hyrule continues its restoration with the aid of the surviving royal family; when an mysterious fog arises underground, Link, Kate, and Zelda go in to investigate, only to find and awaken the real Ganondorf; Ganondorf's attack sends Zelda away, a Master Sword breaks, Link loses his arm, and Hyrule Castle begins floating skyward; Link, Kate, and Sheik must travel around Hyrule once more, even going skyward to find and save Zelda before it's too late.

More details