The Legend Of Zelda - Tale of a Dark Hero
Flooyd
  • Reads 1,707
  • Votes 39
  • Parts 19
  • Time 1h 50m
  • Reads 1,707
  • Votes 39
  • Parts 19
  • Time 1h 50m
Flooyd
Ongoing, First published Nov 05, 2020
adventurebotwbreathbreathofthewildcalamitycastledivinefanficfightganonherohyrulekinglegendlegendofzeldalinklozmipharevalisheikahsidonswordtlozzeldazelink
One day, Link explores what seemed to be the hideout of someone linked to Ganon the Calamity. Inside, a little boy sits on the floor, an empty gaze straying towards Link. Who is he ? What is he doing in this abandoned place ? Link's questions stay unanswered. He decides to bring the boy back with him to the castle, but this will have more consequences than what he could have imagined.
All Rights Reserved
adventurebotwbreathbreathofthewildcalamitycastledivinefanficfightganonherohyrulekinglegendlegendofzeldalinklozmipharevalisheikahsidonswordtlozzeldazelink
Table of contents

19 parts

Sign up to add The Legend Of Zelda - Tale of a Dark Hero to your library and receive updates
or
#134calamity
Content Guidelines
You may also like
Botw Reimagined by fellow_Zeldafan
16 parts Ongoing
If you haven't read the prequel of this story, I highly recommend reading it before starting on this if you don't want to get. confused. Moving from the past of breath of the wild, we finally get to the game portion of the story. (Story) 100 years after the tragedy that was the Great Calamity, Hyrule has finally seemed to have regained its footing. However, the seal on Calamity Ganon seems to be weakening, threatening to break any day now. Fortunately for Hyrule, a hero who has been thought long dead finally returns from a long slumber. That hero is Link. After sleeping for 100 years, Link seems to have lost all of his memories, especially the memories of his failure to protect those that he loved. of course, All rights to any known part of the game go to Nintendo please Nintendo, do not strike me down before I finish this series.
Zora's Domain - The Knight And The Prince by SH27BG3
28 parts Complete Mature
A story about an injured Hylian Knight travelling with a Zoran Prince, their travels are filled with jealousy, sadness, dangerous fights and more. They meet various people on their travels, some that cause arguments, others who help and heal.
His Champion (Sidlink) by howdyhowl
25 parts Complete Mature
After Link defeats Divine Beast Vah Ruta he is teleported just outside the Zora Domain, but his luck runs short when he runs into a group of Yiga Clan. Link gets off with a serious injury, and his closest escape is Zoras Domain. Link arrives and collapses into the arms of the prince of Zoras. Will Sidon have the chance to tell Link his feelings? Or will Links injuries, or maybe something else, take him? There's some fluff, like hardcore, and some smut.
What the Future Holds by shinshinjane
20 parts Complete
A stranger interrupts the Champion ceremony claiming to know what everyone's fates are during the outcome of Ganon's return. With all exits sealed off, the royal family and the champions have no choice but to watch their future unfolds. #1 in Watching
Legend of Zelda, The Kingdom's Tears by GothicMoonlight
23 parts Complete
A few years after the battle with the Calamity, Hyrule continues its restoration with the aid of the surviving royal family; when an mysterious fog arises underground, Link, Kate, and Zelda go in to investigate, only to find and awaken the real Ganondorf; Ganondorf's attack sends Zelda away, a Master Sword breaks, Link loses his arm, and Hyrule Castle begins floating skyward; Link, Kate, and Sheik must travel around Hyrule once more, even going skyward to find and save Zelda before it's too late.
Fabricated Fate - A Breath of the Wild Fanfiction by CapricornSiren
32 parts Complete
A young girl named Thalia is found by Princess Zelda and her knight at the time, Link. Taken into the castle, Thalia has a choice to become a knight herself or an occupation that will help benefit the castle. One day, Princess Zelda gets kidnapped by Ganondorf as Link couldn't stop him. Feeling like it was his fault, Link seeks out to rescue the princess, but he cannot do it alone. **This is a Link x Zelda story **Contains OCs
The Heroes' Rebirth | BOTW Sequel/Zelink (The Legend of Zelda) by HeroOfRhythm
30 parts Complete
~This is a COMPLETED fan-made sequel to Breath of the Wild and Zelink fanfic~ It has been six months after the defeat of Calamity Ganon. Peace and rebirth are beginning to come upon the land of Hyrule once again. Zelda is deep in planning of the repair of Hyrule Castle and Hyrule Castle Town, and Link is busy with the cleansing of the lands from monsters. The two have had almost no time together after their fight with Ganon. As events begin to settle down, and Zelda and Link finally spend time together, Master Kanto, the new leader of the Yiga Clan, hatches a plan to end the "Hero" once and for all and raise darkness and malice over the land again. Much love to you all! Cover art by @ebiebieshrimp -The Legend of Zelda is owned by Nintendo- #1 in loz #1 in hyrule #2 in zelink #2 in botw #2 in zelda
TOTK: The Lonely Hero by Prince_Aeris
50 parts Ongoing
A rewrite of TOTK and a continuation to BOTW: The Lonely Knight It has been five years since the defeat of Calamity Ganon. As Hyrule and its inhabitants strive to rebuild their once despoiled homeland, a new danger begins to awaken. With a potential threat begins to reveal itself, the Princess of Hyrule, Zelda, and the Hero of Hyrule, Link, descend down into the dark underground in search of answers. What they find though is much worse than they could have ever feared. On his own once more, it's up to Link to uncover the mysteries of the past and defend Hyrule once more. But with the sword that seals the darkness gone, Zelda missing, and his strength sapped away, can he even hope to prevail? (None of the artwork here is mine. Link to the artist who made the art of this cover: https://www.artstation.com/artwork/aog3aL )
Remember When...(Link x Reader) by Maple_The_Awesome
61 parts Complete
A hundred years ago, a group of Champions had planned and trained to fight Calamity Ganon. None of them could have predicted what actually ended up happening next: a betrayal from within leading to the destruction of Hyrule. After all those years, Link had awoken with no memory, feeling completely lost in this still healing world. He wouldn't have ever been able to find his way if it wasn't for you, a fellow traveler who has taken it upon herself to aid Hyrule's hero in his quest.
Hyrule Champions (sidlink) by howdyhowl
18 parts Complete
!!! THIS IS NOT THE SEQUEL TO THE REWRITE OF HIS CHAMPION, THIS IS THE ORIGINAL SEQUEL !!! This is the sequel to His Champion. Link has just defeated Calamity Ganon, and saved his best friend, Zelda. Now, they must decide what they should do next to revert Hyrule back to its former glory. I do not own any of these character as they all belong to Nintendo. I do not own any of the art.
You may also like
Slide 1 of 10
Botw Reimagined cover
Zora's Domain - The Knight And The Prince cover
His Champion (Sidlink) cover
What the Future Holds cover
Legend of Zelda, The Kingdom's Tears cover
Fabricated Fate - A Breath of the Wild Fanfiction cover
The Heroes' Rebirth | BOTW Sequel/Zelink (The Legend of Zelda) cover
TOTK: The Lonely Hero cover
Remember When...(Link x Reader) cover
Hyrule Champions (sidlink) cover

Botw Reimagined

16 parts Ongoing

If you haven't read the prequel of this story, I highly recommend reading it before starting on this if you don't want to get. confused. Moving from the past of breath of the wild, we finally get to the game portion of the story. (Story) 100 years after the tragedy that was the Great Calamity, Hyrule has finally seemed to have regained its footing. However, the seal on Calamity Ganon seems to be weakening, threatening to break any day now. Fortunately for Hyrule, a hero who has been thought long dead finally returns from a long slumber. That hero is Link. After sleeping for 100 years, Link seems to have lost all of his memories, especially the memories of his failure to protect those that he loved. of course, All rights to any known part of the game go to Nintendo please Nintendo, do not strike me down before I finish this series.

More details