The Legend Of Zelda - Tale of a Dark Hero
Flooyd
  • Reads 1,707
  • Votes 39
  • Parts 19
  • Time 1h 50m
  • Reads 1,707
  • Votes 39
  • Parts 19
  • Time 1h 50m
Flooyd
Ongoing, First published Nov 05, 2020
adventurebotwbreathbreathofthewildcalamitycastledivinefanficfightganonherohyrulekinglegendlegendofzeldalinklozmipharevalisheikahsidonswordtlozzeldazelink
One day, Link explores what seemed to be the hideout of someone linked to Ganon the Calamity. Inside, a little boy sits on the floor, an empty gaze straying towards Link. Who is he ? What is he doing in this abandoned place ? Link's questions stay unanswered. He decides to bring the boy back with him to the castle, but this will have more consequences than what he could have imagined.
All Rights Reserved
adventurebotwbreathbreathofthewildcalamitycastledivinefanficfightganonherohyrulekinglegendlegendofzeldalinklozmipharevalisheikahsidonswordtlozzeldazelink
Table of contents

19 parts

Sign up to add The Legend Of Zelda - Tale of a Dark Hero to your library and receive updates
or
#402divine
Content Guidelines
You may also like
His Champion (rewrite) by howdyhowl
34 parts Complete Mature
After reclaiming Divine Beast Vah Ruta, Mipha sends Link just outside of Zoras Domain. His luck runs short, however, when he runs into a group of Yiga Clan warriors. He escapes with a serious injury, which lands him in the infirmary in the domain. After his recovery, a feast, and a few revelations, he's ready to reclaim his last memory and free Zelda from Calamity Ganon. Will his destiny stop him from living life to the fullest? Or will he live rather than just survive? !! contains some heavy themes and smut !! !! art is mine, but it's just a placeholder for now !!
The Legend of Zelda: Heroes of Worlds (Breath of the Wild x Male Reader) AU by Nexaverse
42 parts Ongoing Mature
Princess Zelda, her trusty knight, Link, and her fellow champions of Hyrule go on a desperate mission to find and defeat Calamity Ganon. However, when they are about to lose, an occasion occurs, and the gang realizes they are no longer in Hyrule. Meanwhile, Y/N L/N and his family are enjoying themselves until eventually, both worlds meet them and he immediately meets Zelda's advisor, Impa. A skilled samurai and fighter. I don't own any of the characters. All rights go directly to Nintendo.
TOTK: The Lonely Hero by Prince_Aeris
43 parts Ongoing
It has been five years since the defeat of Calamity Ganon. As Hyrule and its inhabitants strive to rebuild their once despoiled homeland, a new danger begins to awaken. With a potential threat begins to reveal itself, the Princess of Hyrule, Zelda, and the Hero of Hyrule, Link, descend down into the dark underground in search of answers. What they find though is much worse than they could have ever feared. On his own once more, it's up to Link to uncover the mysteries of the past and defend Hyrule once more. But with the sword that seals the darkness gone, Zelda missing, and his strength sapped away, can he even hope to prevail? A sequel to BOTW: The Lonely Knight (None of the artwork here is mine. Link to the artist who made the art of this cover: https://www.artstation.com/artwork/aog3aL )
After the Calamity by nayrus_love
15 parts Complete
A sequel to my story, Before the Calamity. After the fight with Ganon, Link and Zelda are reunited. However, things are not as perfect as they should be. The two of them encounter new struggles as they try to readjust in a world with no place for them. Breath of the Wild belongs to Nintendo. Ps- cover art is mine ;)
His Champion (Sidlink) by howdyhowl
25 parts Complete Mature
After Link defeats Divine Beast Vah Ruta he is teleported just outside the Zora Domain, but his luck runs short when he runs into a group of Yiga Clan. Link gets off with a serious injury, and his closest escape is Zoras Domain. Link arrives and collapses into the arms of the prince of Zoras. Will Sidon have the chance to tell Link his feelings? Or will Links injuries, or maybe something else, take him? There's some fluff, like hardcore, and some smut.
Hero by Heart by TheBookOfSnow
78 parts Complete
Zelda and Link have defeated Calamity Ganon and are now free to go their own way. However, it is hard to get to grips with their past, which can get in the way of their present. And as if that isn't hard enough, there seems to be a new threat that they will need to face. This story takes place directly after Breath of the Wild and has no link to its sequel.
The Legend of Zelda: After the Wild by King_Arthur99
39 parts Complete Mature
10 years after the defeat of Calamity Ganon, Hyrule was restored to it's former glory, with Zelda a respected Queen, and Link a celebrated Hero. However, a Yiga uprising brings the Kingdom of Hyrule to a time of civil unrest, and an unlikely group of friends find themselves caught in the middle of the rising conflict, and their own mission appointed by Zelda.
The Princess and Her Knight - A Breath of the Wild FanFiction by nightowl2525
59 parts Complete Mature
Before the Great Calamity, Zelda and Link travel amongst Hyrule together. They must learn to tolerate each other on their journey. Zelda, having barely been able to leave the castle much before him, discovered her sense of adventure when she went out with Link. Is it possible that the two of them harbored a secret admiration for each other than ran deeper than friendship? Or would Link maintain his silence and not speak to the princess at all? This story flashes back from before and after the Great Calamity. What happens after Link defeats Calamity Ganon? This story is very long, but if I do say so myself, I think it's worth it! There will be a sequel. Contains spoilers. I DO NOT OWN THESE CHARACTERS OR ANYTHING/MONOLOGUE THAT HAPPENED IN THE GAME, it belongs to Nintendo. Some parts of the story however did not occur in the game. I hope you enjoy! Contains violence and some implications of sex. Cover art to Eorinamo, https://www.pinterest.com/amp/pin/541769030169781166/
Couple of the Wild (ZeLink) by Kenlair
78 parts Complete
𝐁𝐨𝐨𝐤 1: 𝐓𝐡𝐞 𝐂𝐨𝐮𝐩𝐥𝐞 𝐒𝐞𝐫𝐢𝐞𝐬 The Calamity Ganon-an ancient evil which has plagued the Kingdom of Hyrule for a century-has fallen to the hands of the hero, Link, and the princess, Zelda. Though they were victorious in sealing the beast, the monstrous servants of the Calamity still linger, and the most of the kingdom was lost to time and taken over by the wild. Opting to forgo their titles and start a new life as regular travelers before starting to rebuild the kingdom, Link and Zelda begin their new life in the Era of the Wild, trying to discover why the monsters still exist. Little do they know, someone might be guiding them toward a quite unexpected trial... 𝑬𝒅𝒊𝒕𝒐𝒓𝒊𝒂𝒍 @Mmmm___Vegany (Twitter) @CaptnMoss (Twitter) @golden_hylian (Wattpad) @SolusVulpus (Archive of Our Own) 𝑨𝒓𝒕𝒊𝒔𝒕𝒔 @Hanabelink (Twitter) @CaptnMoss (Twitter) @Mozzygan (Twitter) @Enayru (Twitter) @Za85bon (Twitter)
The Heroes' Rebirth - REVISITED | BOTW Sequel/Zelink (The Legend of Zelda) by HeroOfRhythm
27 parts Complete
~Having returned after two years, I decided to edit The Heroes' Rebirth. I changed (hopefully) all of the spelling errors, fixed the grammar and changed some of the sequences of events. I added some extra scenes as well. Hope you enjoy the revised version :) HR It has been six months after the defeat of Calamity Ganon. Peace and rebirth are beginning to come upon the land of Hyrule once again. Zelda is deep in planning of the repair of Hyrule Castle and Hyrule Castle Town, and Link is busy with the cleansing of the lands from monsters. The two have had almost no time together after their fight with Ganon. As events begin to settle down, and Zelda and Link finally spend time together, Master Kanto, the new leader of the Yiga Clan, hatches a plan to end the "Hero" once and for all and raise darkness and malice over the land Cover art by @ebiebieshrimp -The Legend of Zelda is owned by Nintendo-
You may also like
Slide 1 of 10
His Champion (rewrite) cover
The Legend of Zelda: Heroes of Worlds (Breath of the Wild x Male Reader) AU cover
TOTK: The Lonely Hero cover
After the Calamity cover
His Champion (Sidlink) cover
Hero by Heart cover
The Legend of Zelda: After the Wild cover
The Princess and Her Knight - A Breath of the Wild FanFiction cover
Couple of the Wild (ZeLink) cover
The Heroes' Rebirth - REVISITED | BOTW Sequel/Zelink (The Legend of Zelda) cover

His Champion (rewrite)

34 parts Complete Mature

After reclaiming Divine Beast Vah Ruta, Mipha sends Link just outside of Zoras Domain. His luck runs short, however, when he runs into a group of Yiga Clan warriors. He escapes with a serious injury, which lands him in the infirmary in the domain. After his recovery, a feast, and a few revelations, he's ready to reclaim his last memory and free Zelda from Calamity Ganon. Will his destiny stop him from living life to the fullest? Or will he live rather than just survive? !! contains some heavy themes and smut !! !! art is mine, but it's just a placeholder for now !!

More details