Story cover for Ellipsism by EnyaEtnica
Ellipsism
EnyaEtnica
  • WpView
    Reads 4
  • WpVote
    Votes 1
  • WpPart
    Parts 1
  • WpHistory
    Time 5m
  • WpView
    Reads 4
  • WpVote
    Votes 1
  • WpPart
    Parts 1
  • WpHistory
    Time 5m
EnyaEtnica
Ongoing, First published Dec 02, 2020
1300s1400s1500sbloodcastledramafamilyfamily-dramakingmedievalmurderpprinceprincessqueenromanceromaniaroyalcoreroyalfamilyroyaltyrroyalsad
1512, Sibiu, Romania.
Vladislav Vulturi ruled over the Kingdom of Sibiu alongside his queen. But one day, Iris-their eldest daughter-stumbled upon a small wooden box that unveiled a truth far greater than she could have imagined.
What followed was a chain of tragic events that would change the lives of the Vulturi family forever.
All Rights Reserved
1300s1400s1500sbloodcastledramafamilyfamily-dramakingmedievalmurderpprinceprincessqueenromanceromaniaroyalcoreroyalfamilyroyaltyrroyalsad
Table of contents

1 part

Sign up to add Ellipsism to your library and receive updates
or
#3rroyal
Content Guidelines
You may also like
𝐌𝐚𝐟𝐢𝐚 𝐊𝐢𝐧𝐠'𝐬 𝐢𝐧𝐧𝐨𝐜𝐞𝐧𝐭 𝐛𝐢𝐰𝐢 by fictionflare_
50 parts Ongoing Mature
He never believed in love, but she captured his heart the moment he saw her. She didn't understand love, but he gained her trust instantly. He is consumed by a desire for revenge. She is as serene as water. He's the mafia king of all Asia, hardened by the world's cruelty from a young age. She spent her entire life in captivity, completely oblivious to the outside world. This is the story of Rudraksha Malhotra and Ruhanika Rajpurohit, two people who couldn't be more different, bound together by the ties of marriage. Can they conquer their inner demons and find peace together? Will Rudraksha allow Ruhanika to rule his heart? Will Ruhanika let Rudraksha love her? Let's find out together. Tropes: Age gap Mafia king × Caged princess Forced marriage Cunning × Innocent Two broken Souls
𝐕𝐞𝐢𝐥 𝐨𝐟 𝐕𝐞𝐧𝐠𝐞𝐚𝐧𝐜𝐞: 𝐀 𝐋𝐨𝐯𝐞 𝐑𝐞𝐤𝐢𝐧𝐝𝐥𝐞𝐝 by DRG_noblestic
45 parts Ongoing Mature
𝐒𝐞𝐪𝐮𝐞𝐥 𝐨𝐟 𝐌𝐲 𝐀𝐫𝐫𝐚𝐧𝐠𝐞𝐝 𝐁𝐫𝐢𝐝𝐞: 𝐄𝐦𝐛𝐞𝐫𝐬 𝐨𝐟 𝐋𝐨𝐯𝐞 & 𝐑𝐞𝐯𝐞𝐧𝐠𝐞 𝐁𝐨𝐨𝐤 𝟐: 𝐓𝐡𝐞 𝐑𝐚𝐣𝐩𝐮𝐭 𝐋𝐞𝐠𝐚𝐜𝐲: 𝐇𝐞𝐚𝐭𝐬 𝐢𝐧 𝐅𝐥𝐚𝐦𝐞𝐬 𝑳𝒐𝒗𝒆 𝒐𝒏𝒄𝒆 𝒍𝒐𝒔𝒕 𝒊𝒔 𝒏𝒐𝒕 𝒆𝒂𝒔𝒊𝒍𝒚 𝒇𝒐𝒖𝒏𝒅 𝒂𝒈𝒂𝒊𝒏, 𝒆𝒔𝒑𝒆𝒄𝒊𝒂𝒍𝒍𝒚 𝒘𝒉𝒆𝒏 𝒗𝒆𝒏𝒈𝒆𝒂𝒏𝒄𝒆 𝒔𝒕𝒂𝒏𝒅𝒔 𝒊𝒏 𝒊𝒕𝒔 𝒘𝒂𝒚. 𝑽𝒆𝒊𝒍 𝒐𝒇 𝑽𝒆𝒏𝒈𝒆𝒂𝒏𝒄𝒆 𝒇𝒐𝒍𝒍𝒐𝒘𝒔 𝒕𝒉𝒆 𝒔𝒕𝒐𝒓𝒎𝒚 𝒕𝒂𝒍𝒆 𝒐𝒇 𝑽𝒊𝒏𝒂𝒚 𝒂𝒏𝒅 𝑺𝒂𝒏𝒚𝒖𝒌𝒕𝒂, 𝒘𝒉𝒐𝒔𝒆 𝒄𝒉𝒊𝒍𝒅𝒉𝒐𝒐𝒅 𝒍𝒐𝒗𝒆 𝒘𝒂𝒔 𝒔𝒉𝒂𝒕𝒕𝒆𝒓𝒆𝒅 𝒃𝒚 𝒂 𝒕𝒓𝒂𝒈𝒊𝒄 𝒇𝒂𝒎𝒊𝒍𝒚 𝒑𝒂𝒔𝒕 𝒂𝒏𝒅 𝒃𝒍𝒐𝒐𝒅𝒔𝒉𝒆𝒅. 𝑭𝒂𝒕𝒆 𝒕𝒐𝒓𝒆 𝒕𝒉𝒆𝒎 𝒂𝒑𝒂𝒓𝒕, 𝒉𝒆 𝒍𝒐𝒔𝒕 𝒆𝒗𝒆𝒓𝒚𝒕𝒉𝒊𝒏𝒈, 𝒂𝒏𝒅 𝒔𝒉𝒆 𝒘𝒂𝒔 𝒍𝒆𝒇𝒕 𝒔𝒉𝒂𝒕𝒕𝒆𝒓𝒆𝒅, 𝒅𝒓𝒐𝒘𝒏𝒊𝒏𝒈 𝒊𝒏 𝒕𝒉𝒆 𝒍𝒐𝒏𝒈𝒊𝒏𝒈 𝒇𝒐𝒓 𝒉𝒆𝒓 𝒌𝒊𝒅𝒏𝒂𝒑𝒑𝒆𝒅 𝒔𝒊𝒔𝒕𝒆𝒓 𝒃𝒆𝒇𝒐𝒓𝒆 𝒔𝒍𝒊𝒑𝒑𝒊𝒏𝒈 𝒊𝒏𝒕𝒐 𝒂 𝒄𝒐𝒎𝒂. 𝒀𝒆𝒕, 𝒕𝒉𝒓𝒐𝒖𝒈𝒉 𝒕𝒉𝒆 𝒑𝒂𝒔𝒔𝒊𝒏𝒈 𝒚𝒆𝒂𝒓𝒔, 𝑽𝒊𝒏𝒂𝒚 𝒘𝒂𝒊𝒕𝒆𝒅-𝒘𝒊𝒕𝒉 𝒖𝒏𝒘𝒂𝒗𝒆𝒓𝒊𝒏𝒈 𝒅𝒆𝒅𝒊𝒄𝒂𝒕𝒊𝒐𝒏 𝒂𝒏𝒅 𝒉𝒐𝒑𝒆, 𝒕𝒐 𝒔𝒆𝒆 𝑺𝒂𝒏𝒚𝒖𝒌𝒕𝒂 𝒐𝒏𝒄𝒆 𝒎𝒐𝒓𝒆. Copyright © [202
Bound by BriSummers95
51 parts Complete Mature
In the shadowed heart of Transylvania, Vlad Dracula rules his castle and his brides with a ruthless hand, seeking a power beyond even his immortal reach. When Isolde, a young mortal with an unknowable heritage, stumbles into his domain, Vlad senses in her the ancient force he requires. As Vlad's obsession with controlling Isolde's power grows, alliances fracture, and his brides struggle with their own loyalties. But Isolde, unaware of her true nature, begins to awaken to both her potential and the darkness surrounding her. In a world bound by blood and betrayal, the fate of the immortal and mortal realms hangs in a perilous balance.
Orphan Dreams by rawazKhammas
13 parts Complete
Emmy, an overworked orphan, carries a mountain load of responsibilities. she doesn't mind them what she minds is the rich people who continue to make her life miserable. Her way of coping is to dream of a better future. One where she is whisked away by the masked stranger who saved her from unspeakable horror on a dark summer night. However; she didn't expect for her life to become more complicated. Now she has to survive the threat of being kicked into the streets. Not to mention the new strangers who come into their village. But the greatest threat is imposed by Lord Alexander who looks at her as if she is anything but a stranger, and carries a secret that could destroy everything.
[completed]Taken From The King by adorkablenerd102
25 parts Complete
PS: I suck at descriptions PPS:THIS STORY IS GOING THROUGH A MAJOR REVAMP Everything was perfect, until it wasn't. Their lives are filled with the most drama you have ever seen and of course it leads to death. Join them in this hell that they call life and see what happens when she's taken from the king.
Blood & Thrones - Bound by Fate by Stefan19IDK
30 parts Ongoing
In a land torn by war and bloodshed, humans and vampires have been sworn enemies for centuries. But when Prince Stephan of Valhalla crosses paths with Seraphina, a vampire princess of Transylvania, they realize that their hatred is not their own, but a force orchestrated by those who fear unity. As they fight their way back to Valhalla, facing betrayals, war, and an ancient evil lurking in the shadows, they must decide: will they be the harbingers of peace, or the catalysts of destruction?
The Queen Games by OKKAAYY25
22 parts Complete
Part One of the Queen Series * King Vincent has grown old and his Secret Son has come of age. The 1000th year is upon us And The Queen Games begins But what if the secret son has a hidden secret that renders the mating impossible? How can the Queen Games finish?
The Vampire King by miss__imperfection_
47 parts Complete
Highest rank - #1 in Vampire ** In a world far beyond human imagination, into the deep roots of the vampire realm he ruled. For over a century, he's known to be the most powerful king. But when a prophecy hints at his destruction, he would do anything to save his empire from crumbling. The cause? A human girl. Upon hearing about the future, he snatches her away from everything she has ever known and traps her within the cold walls of his dungeons. Could she be the cause of his destruction? Or will he destroy her first? Leaving her to pick up her own broken pieces before she can be an ounce of a threat to him. You're welcomed to explore this world where only bloodthirsty creatures , lies, betrayal, and darkness exist. But don't be surprised if you discover LOVE along the way... ** Cover by- @forcade Copyright © 2021 WARNING** Contains inappropriate content, must be 14+ to read. [Word count: 75,000 to 90,000] Enjoy.
Vlad by noodlelover_1
44 parts Complete Mature
Vlad Dracula, spawn of the devil. After years of searching, he's found the doppelganger of his beloved, and he will do anything to make sure he gets her. Anything. .... Melanie seems to attract the wrong attention. She's an outsider to most. But to him, to Vlad, she's the most precious thing in the world. He needs her. For 2000 years he walked the earth, searching for every doppelganger of his beloved Rosalie, trying to spend as many lifetimes with her as he can. Love, to a vampire, is the most powerful emotion. Next to lust :)
Rudra Tara by authordivyaa
69 parts Ongoing Mature
𝑩𝒐𝒐𝒌 𝑻𝒘𝒐 𝒐𝒇 𝒔𝒆𝒓𝒊𝒆𝒔 𝑻𝒉𝒆 𝑹𝒐𝒚𝒂𝒍𝒔 ⋆˚☆˖°⋆｡° ✮˖ ࣪ ⊹⋆.˚ "𝐈 𝐰𝐚𝐧𝐭 𝐭𝐨 𝐥𝐨𝐯𝐞 𝐲𝐨𝐮 𝐢𝐧 𝐞𝐯𝐞𝐫𝐲 𝐩𝐨𝐬𝐬𝐢𝐛𝐥𝐞 𝐰𝐚𝐲. 𝐖𝐡𝐞𝐭𝐡𝐞𝐫 𝐢𝐭'𝐬 𝐛𝐞𝐜𝐨𝐦𝐢𝐧𝐠 𝐲𝐨𝐮𝐫 𝐜𝐨𝐦𝐟𝐨𝐫𝐭 𝐩𝐥𝐚𝐜𝐞 𝐨𝐫 𝐭𝐡𝐞 𝐨𝐧𝐞 𝐰𝐡𝐨 𝐮𝐭𝐭𝐞𝐫𝐥𝐲 𝐫𝐮𝐢𝐧𝐬 𝐲𝐨𝐮 𝐢𝐧 𝐛𝐞𝐝,𝐓𝐚𝐫𝐚" ✮ ⋆ ˚｡𖦹 ⋆｡°✩ ★ 𝐑𝐮𝐝𝐫𝐚𝐤𝐬𝐡 ᥫ᭡ 𝐓𝐚𝐫𝐚 ★ ✮ ⋆ ˚｡𖦹 ⋆｡°✩ Start : 13.03.2024 End :
You may also like
Slide 1 of 10
�𝐌𝐚𝐟𝐢𝐚 𝐊𝐢𝐧𝐠'𝐬 𝐢𝐧𝐧𝐨𝐜𝐞𝐧𝐭 𝐛𝐢𝐰𝐢 cover
𝐕𝐞𝐢𝐥 𝐨𝐟 𝐕𝐞𝐧𝐠𝐞𝐚𝐧𝐜𝐞: 𝐀 𝐋𝐨𝐯𝐞 𝐑𝐞𝐤𝐢𝐧𝐝𝐥𝐞𝐝 cover
Bound cover
Orphan Dreams cover
[completed]Taken From The King cover
Blood & Thrones - Bound by Fate cover
The Queen Games cover
The Vampire King cover
Vlad cover
Rudra Tara cover

𝐌𝐚𝐟𝐢𝐚 𝐊𝐢𝐧𝐠'𝐬 𝐢𝐧𝐧𝐨𝐜𝐞𝐧𝐭 𝐛𝐢𝐰𝐢

50 parts Ongoing Mature

He never believed in love, but she captured his heart the moment he saw her. She didn't understand love, but he gained her trust instantly. He is consumed by a desire for revenge. She is as serene as water. He's the mafia king of all Asia, hardened by the world's cruelty from a young age. She spent her entire life in captivity, completely oblivious to the outside world. This is the story of Rudraksha Malhotra and Ruhanika Rajpurohit, two people who couldn't be more different, bound together by the ties of marriage. Can they conquer their inner demons and find peace together? Will Rudraksha allow Ruhanika to rule his heart? Will Ruhanika let Rudraksha love her? Let's find out together. Tropes: Age gap Mafia king × Caged princess Forced marriage Cunning × Innocent Two broken Souls

More details