Unholyverse
kenziekitten01
  • Reads 222,578
  • Votes 9,692
  • Parts 26
  • Time 4h 28m
  • Reads 222,578
  • Votes 9,692
  • Parts 26
  • Time 4h 28m
kenziekitten01
Complete, First published Oct 30, 2014
Mature
frankierofrerardgerardwaymikeywaymychemicalromanceraytoro
"He thinks I have stigmata," Frank said, because what the fucking hell, it couldn't get any worse. He might as well just lay it out.

"Oh, well," said Brian into his hands. "Of course."

~

I did not write this story.
All credit goes to the author,
Bexless on Archive Of Our Own.
Link to the original story:
http://archiveofourown.org/series/9795
Public Domain
frankierofrerardgerardwaymikeywaymychemicalromanceraytoro
Table of contents

26 parts

Sign up to add Unholyverse to your library and receive updates
or
Content Guidelines
You may also like
Demigods at Goode by heavensghost
23 parts Complete
"I'm Amber and this isn't the life I asked for." What happens when Percy gets sent back to Goode after the war with Gaea? What happens when the other demigods come as well? What happens when they meet Amber Persephone Bobofit?
Total High School by ashleyisoffline
41 parts Complete
yea just another tdi high school au I know I'm so original. But in this au Total Drama never happened. Now the characters just go to high school together. (This is mostly a noco fic) Ships include: Trustin Lyler(Lindsay and Tyler) Aleheather Gidgette (Bridgette and Geoff) Izva Noco Duncney
Another Frerard Story... by frerardmonstermcr
15 parts Complete
When a new guy (Frank Iero) starts at boarding school, he meets many new people including his roommate (Gerard Way) they have a rough start and go through many challenging twists and turns. Frank thinks he might have developed feelings for the artistic heart throb, but will his roomie feel the same?
what's stopping you? by michealhehee
36 parts Complete Mature
"π–œπ–π–ž? 𝖙𝖍𝖆𝖙'π–˜ π–˜π–” π–œπ–Šπ–Žπ–—π–‰. π–‘π–Žπ–π–Š, π–Žπ–“π–˜π–™π–Šπ–†π–‰ 𝖔𝖋 'π–π–Šπ–—π–Š'π–˜ π–’π–ž π–π–”π–”π–‰π–Žπ–Š' π–Žπ–™'π–˜ 'π–π–†π–›π–Š π–’π–ž π–‹π–šπ–ˆπ–π–Žπ–“π–Œ π–•π–†π–“π–™π–˜'?" "π–™π–—π–”π–šπ–˜π–Šπ–—π–˜ π–˜π–†π–•π–“π–†π–•, 𝖓𝖔𝖙 π–•π–†π–“π–™π–˜." πͺ𐑂 β™‘ or, in which two boys move to england for a fresh start and end up getting more than just that.
Finally Free πŸ‘»πŸ’œπŸ’™ by iloveatlasc0rrigan
26 parts Complete
Basically my take on jatp Season 2
Mr. Flirty [Song Mingi X Reader] by bvbbleimagines
38 parts Complete
You moved back to Seoul, South Korea. But your neighbor, who stays in the apartment right in front of your room, tries to flirt with you but you keep ignoring him being unaware of the fact that he will become your boss. Will you be successful in building up a better relationship with Mr. Flirty or ruin it? Best ranking - 3: #songmingi 1:#mingi on 29th January,2025
COWGIRLS! | Yellowstone by religioninyourlips
84 parts Ongoing
"long live cowgirls." - in which the youngest of the dutton clan comes home [yellowstone] [ryan x oc] [book one]
α΄‡ΚŸΚκœ±Ιͺα΄€Ι΄ | BNHA by sxftreo
87 parts Complete
Various BNHA X Fem Reader. Where an inauspicious girl meets her doom and ultimately gets transported into the chaos of My Hero Academia.
Masked Obsession by ILoveDrarryAndAnime
53 parts Ongoing
"You're different from what I expected," she said softly. "How so?" he asked, glancing at her. "I don't know," she replied, searching for the right words. "You just... have this way of making people feel like they matter. Even here, in this... nightmare." He was quiet for a moment before responding. "You matter, Y/n. Don't forget that." OR Y/n wakes up in the deadly Squid Game, surrounded by strangers and fighting to survive. What she doesn't know is that the mysterious Frontman is watching her every move through the cameras- and she's caught his attention.
My Chemical Romance: Ferard by MACnCHEESE5329
29 parts Complete
Gerard has had feelings for Frank for a while. But how will Frank handle it after Gerard kisses him on stage?
You may also like
Slide 1 of 10
Demigods at Goode cover
Total High School cover
Another Frerard Story... cover
what's stopping you? cover
Finally Free πŸ‘»πŸ’œπŸ’™ cover
Mr. Flirty [Song Mingi X Reader] cover
COWGIRLS! | Yellowstone cover
α΄‡ΚŸΚκœ±Ιͺα΄€Ι΄ | BNHA cover
Masked Obsession cover
My Chemical Romance: Ferard cover

Demigods at Goode

23 parts Complete

"I'm Amber and this isn't the life I asked for." What happens when Percy gets sent back to Goode after the war with Gaea? What happens when the other demigods come as well? What happens when they meet Amber Persephone Bobofit?

More details