Story cover for The move to the better *Kian lawley and Sam pottorff fanfic* by imTHEunicorn
The move to the better *Kian lawley and Sam pottorff fanfic*
imTHEunicorn
  • WpView
    Reads 40,573
  • WpVote
    Votes 387
  • WpPart
    Parts 16
  • WpHistory
    Time 1h 34m
  • WpView
    Reads 40,573
  • WpVote
    Votes 387
  • WpPart
    Parts 16
  • WpHistory
    Time 1h 34m
imTHEunicorn
Ongoing, First published Nov 04, 2012
aboutabuseboyboyfriendfanfanficgirlkianlawleymovepottorffsamsuperkian13swedenusayoutube
So english isnt my first  langue, so be nice. but id like to learn more so tell me if im writing something wierd and stuff like that.
This story is about Lucinda, she is 16 years old. Her life changes when her mom accepts a job. in cali-fucking-fornia- in U-fucking-S. she moves from sweden to cali. She meets kian and sam. And then what?

this story is about friendship, distance, romance, teen problems and more. enjoy.
All Rights Reserved
aboutabuseboyboyfriendfanfanficgirlkianlawleymovepottorffsamsuperkian13swedenusayoutube
Table of contents

16 parts

Sign up to add The move to the better *Kian lawley and Sam pottorff fanfic* to your library and receive updates
or
#14pottorff
Content Guidelines
You may also like
Give Me Love by mycyberlife
47 parts Complete
******** Read first********* I wrote this when I was like 12. I have not read a page since. I cannot tell you if this story will be grammatically accurate at all. I figured I'd leave it up for the memories haha. Read at your own risk. Ally lived in New York for most of her life. She has been bullied since grade 8 because she made YouTube videos. When she finally graduates high school she becomes a famous YouTuber and moves to California. What happens when she runs into the one and only Ricky Dillon? Will she fall in love or just get heart broken?
Kian Lawleys Sister by nicolenbv
45 parts Complete
I wrote this book in 2016 when I was 14... I'm now for some reason having a blast from the past and re-reading this at 20 yrs old and y'all... PLEASE know that I was mf 14 years of age LOL. The story isn't half bad. But the whiplash you'll get from the sequence of events going so fast.. be ready. Nicole Lawley, an 18 yead old girl who lives in San Antonio, Texas with her best friend Jc Caylen. Unfortunatly, Nicole gets bullied in school, not to the point where she's physically hurt, but emotionally. No one but Jc knows about it. When her senior year in high school ends, her and Jc decide to pack their things and fly out to Los Angles to live with Kian and the rest of O2L. Little does Nicole know what the universe has instore for her in Los Angeles, but she hopes its better than what she had in San Antonio.
In A Matter Of Seconds (o2l) by totallytesss
59 parts Complete Mature
An O2L fan fiction about a girl named Laina Scaltes who goes to California in search of deepening love, and ends up finding herself and another family along the way.
Until you came along.|| Jake Webber x Reader ‼️ Discontinued‼️ by unconfidentSinger
34 parts Complete Mature
Heyo! So this is my first story! So sorry if it sucks. Basically it's about this girl who moves to LA for reasons (you will find out later) and she was one of Corey's best friends so he invites her to live with him. Little did she know a certain amazing boy would help her feel alive again (Edit: Slowish updates at this time!!!!!!) ❗️❗️TRIGGER WARNING❗️❗️ There is abuse and self harm and there might be some lemon type stuff but I don't know yet also swearing! Omg best ranking was 9 for jakewebber
Forever And Always (Kian Lawley) by anaasantos_
69 parts Complete
Chloe Lee Anne a normal 17 year old living in California with both her parents, her little sister and her brother Sam Porttoff they join with 4 other guys and soon are living together. Chloe falls for one of them but is it the right choice? Like everyone she has a bad past which they will soon learn about, and like every bad past they come back sooner or later, can she live through the pain? ❤️ Forever and Always a Kian Lawley FanFic ❤️ Warning: story contains mature contents, bad language and sexual contents please do not read if you are uncomfortable!
Ever since you came. (Trevor Moran Fanfic) by Mango_cheeks
63 parts Complete Mature
Maddison Lawley is Kian Lawley's little sister her whole life she has been growing up with Being abused and neglected. She cant find any other safe place then when She Stays with Kian, Jc or Sam... She has always been the rebellious child, Running from home, getting suspended from school and being unable to trust anyone. She soon meets the rest of the O2L group and bonds with them Instantly. But that's where things go wrong. Social workers, Trauma of the past, abuse and heartbreak. Just you average Teenage story but with a little more Cuss words. WARNING: This story has strong language and abuse so if you don't like that stuff don't read this or Read it with caution. You have been warned.
𝐛𝐮𝐥𝐥𝐢𝐞𝐝 𝐛𝐲 𝑫𝒂𝒏 𝑯𝒐𝒘𝒆𝒍𝒍 | 𝐚𝐮 by wandasdream777
28 parts Complete Mature
*I wrote this when was 13 and when I thought I was the shit so please excuse some bad writing* ˚*･༓ Hey, I'm Aubrey, but people call me Auby. I'm 17 and I have the most amazing friends in the world. Tyler, Troye and Zoe. Everything in my life is amazing. Except for one thing. Dan Howell. My bully. The person who makes, or used to at least, make my life a living hell. ˚*･༓ Ready as Aubrey and her friends figure out a way to escape a mystery psychopath with the company of their new found friend, Dan Howell.
Casual Little Love Story by Jlo_Lovely_
29 parts Complete
{Book 1} Samantha has lived in California all her life and she has so many friends,she's a Youtuber and Her Brother is Kian Lawley. She has a perfect life ,but,will she be able to go through the heartaches of having a relationship with Sam Pottorff? Find out in Casual Little Love Story
Kian Lawley*COMPLETED* by LouisAnd_HarrysBaby
26 parts Complete Mature
Ashley is a girl from Minnesota and she meets Kian and her life changes forever or better or worse? and what happens when people from her past come into the story and we find out a little bit more about her past read to find out
Teenage Dream by JessicaLockhart2
33 parts Complete
Adalynne is 18 and moved to California from Texas to live with her dad for college. She's your average teenager she enjoys hanging with friends and watching and making YouTube videos. She was friends with the one and only Jc Caylen growing up. What will happen when she runs into him again? Will she fall for his friend or the guy her dad wants her to marry? A Kian Lawley Fanfic.
You may also like
Slide 1 of 10
Give Me Love cover
Kian Lawleys Sister cover
In A Matter Of Seconds (o2l) cover
Until you came along.|| Jake Webber x Reader ‼️ Discontinued‼️ cover
Forever And Always (Kian Lawley) cover
Ever since you came. (Trevor Moran Fanfic) cover
𝐛𝐮𝐥𝐥𝐢𝐞𝐝 𝐛𝐲 𝑫𝒂𝒏 𝑯𝒐𝒘𝒆𝒍𝒍 | 𝐚𝐮 cover
Casual Little Love Story cover
Kian Lawley*COMPLETED* cover
Teenage Dream cover

Give Me Love

47 parts Complete

******** Read first********* I wrote this when I was like 12. I have not read a page since. I cannot tell you if this story will be grammatically accurate at all. I figured I'd leave it up for the memories haha. Read at your own risk. Ally lived in New York for most of her life. She has been bullied since grade 8 because she made YouTube videos. When she finally graduates high school she becomes a famous YouTuber and moves to California. What happens when she runs into the one and only Ricky Dillon? Will she fall in love or just get heart broken?

More details