An Experience
Originalfox
  • Reads 20
  • Votes 6
  • Parts 21
  • Time 4h 53m
  • Reads 20
  • Votes 6
  • Parts 21
  • Time 4h 53m
Originalfox
Ongoing, First published Feb 15, 2021
Mature
animalscolddarkdarkfantasydarklovedarkmagicfantasyganglifegangshorrorhorror-thrillerlgbtlgbt-themedlgbtfictionlgbtlovelgbtpridemafiamurdermysterywerebeastwerewolfwinter
Avilion is young. After it's birth known as the Great Collision, the survivors of its destruction worked to rebuild the life they knew before, with a few biological changes.

Autumn DuPond was born into this world, all they've ever known is the frozen half of Avilion, while all they've ever known about the other half is that it's on fire. Sheltered, blind to the world around them, and alone since the moment of birth Autumn just wants to get out of the cruel city they've grown up in. When their wish is granted... They get a little more than they asked for.

Thrust into a world of lies, corruption, mafia families, death, and werebeasts, Autumn finally gets their glimpse of the world they've been desperate to experience... However, they may not be prepared for how dark it really is.
All Rights Reserved
animalscolddarkdarkfantasydarklovedarkmagicfantasyganglifegangshorrorhorror-thrillerlgbtlgbt-themedlgbtfictionlgbtlovelgbtpridemafiamurdermysterywerebeastwerewolfwinter
Table of contents

21 parts

Sign up to add An Experience to your library and receive updates
or
Content Guidelines
You may also like
Shattered Hearts by theRaeofSunshine2
13 parts Ongoing Mature
"Are you French? Because Eiffel for you." I say to her. She laughs. I can't even explain how my much I love her breathtaking taking laugh. The way her eyes squirt at the corners. Her nose scrunches up just a little bit. A light pink blush spreads across her face. She is perfect. I think it goes without question. I love her. Avyanna: a friendly, pretty,and smart girl. She will do anything to achieve her dreams. While continuously fighting the demons of her past. Grey: A handsome, smart, and athletic boy. Still mourning the loss of his late brother, he is moved to a new city. Starting over again. Avyanna and Grey have both suffered from a terrible past. They both struggle with opening and expressing their emotions to others. When their journalism teacher pairs them together for a writing assignment about one another, they become acquaintances. Will this lead to something bigger? And most importantly will they find solace in one another?
His Addiction {COMPLETED} by nessybbe
50 parts Complete Mature
Two worlds of no connections are brought together under distressing circumstances purely out of misunderstanding. When he can't let go of his past and when the future matters the most to her, the sea is always unsettling Find out what can actually bring this two people together, venture down the mood swinging lane with me. Don't forget to grab a popcorn when you're reading this!! P.S: This story is dedicated to every single reader out there, your opinion matters the most, just keep doing your good work, it is much appreciated. Still your lovely writer Nessybbe Follow Comment And like me on Instagram Instagram ID: ness-ybby
Vitality (Vitality Series #1) by Crysta_levere_author
67 parts Complete Mature
A violent passion. A dangerous bond. A nightmare that will change everything. To Ava, love is about as real as fairytales. But it might be that fairytales, myths, and magic have some truth to them after all - as well as the monsters that lie in the shadows. Or she could just be completely out of her mind. After a mental breakdown and a move to a new town, everything changes when Ava clashes with a stranger with eyes as black as midnight and a terrifying sinister air. Her wishes to feel something again become granted. But Ava soon learns that not only is he as cold as he is beautiful, but he brings something out of her, stronger than ever, like fuel to fire - something she's desperate to bury. He haunts her dreams and waking life, and staying away becomes harder than she could have ever imagined, risking her life, her humanity, and the people that she cares about. Not to mention the fate of the world. She's fighting for life. He's fighting for death. What does it take to live? What does it take to love?
The Only Queen by spoiledbrathani
38 parts Complete Mature
[MAFIA ROMANCE, RATED R] "I catch a lot of attention these days," she purred, her voice dripping with seductive allure as she toyed with Cedric's expectations. "But you haven't quite managed to capture mine yet," she teased, her tone coy yet tantalizing. Cedric's expression darkened slightly, a predatory gleam in his eyes as he stepped closer to Lilith, the air charged with electricity between them. "I always get what I want, when I want," he growled softly, his voice low and commanding as he locked eyes with her. ~ In the heart of the male-dominated underworld, Lilith emerges as a formidable force, crowned as the sole queen among her four brothers. It's a destiny written before her birth, a path she must walk to uphold her family's legacy. Tasked by her oldest brother, Lucifer, with using her feminine charm to navigate the treacherous world of organized crime, Lilith finds herself entangled in a web of intrigue, unaware of the intricate game Lucifer is playing. Sin City is akin to hell itself, a domain where Lucifer holds sway, and Lilith is destined to become the Queen of Hell. As Lilith embraces her role, her journey collides with Cedric, an ambitious underworld king ruling the streets of New York. Cedric is determined to make Lilith his queen, regardless of the consequences. Their meeting ignites a fierce clash of wills and desires, propelling them into a whirlwind adventure through the dangerous streets of Sin City and New York. Bound by duty to fulfill her family's legacy by producing an heir, and Cedric's need for a queen to reign over New York, their attraction becomes undeniable. Yet, they must navigate the complexities of their forbidden love, determined to find a way to make it work against all odds, even as the powers of hell itself watch their every move.
Burn Me Right by Nyxiden
96 parts Complete Mature
Autumn Wraith took a step a 20-year-old shouldn't take. She was naïve for her own ruin. One wrong move, or should we say one wrong article? She writes about him, not knowing her pen was the knife that was going to turn on her. Her life was anchored to the devil. The devil vowed to keep her as his. Will she survive his obsession? Zyler Stone, 27. They say the devil was once an angel. But this man taught tricks to the horn-headed beast himself. What happens when he falls for a girl he vowed to kill? He was supposed to kill her, but for the first time, his hands couldn't fire that gun. He couldn't kill her. Instead, he decided to keep her for himself. The devil went far for her, too far that she couldn't take it. Will she move to hell with him, or will he move heaven and earth for her? Despite his initial intention to silence her, Zyler made her his. Obsessed with every move she made, he watched from the shadows, consumed by a dark desire he couldn't control. As Autumn's life begins to spiral out of control, she realizes that there's no escape from the darkness that surrounds her. In this heart-stopping tale of danger and desire, Autumn and Zyler are pitted against each other in a battle for control. But as their obsession spirals out of control, it becomes clear that only one of them will emerge from the darkness alive.
(Blood Bound)Eternal Winter by hedgienab
13 parts Complete Mature
Please Note, I'm thinking of changing the title from Blood Bound to Eternal Winter, or even something else. Any ideas, feel free to inbox me! "You're a monster.." His teeth were gritted, eyes wide. I shrugged, "Maybe, but I'm your monster." Greyson Black's girlfriend died months ago, leaving him half a person. Until he catches a case that follows him home. This story contains one rather explicit sex scene which I may take out and put in a new section all its own. Chapters are long even though there aren't many.
Bonded By Fate [2nd Generation]: What Are We? by Mochi_SolSol
14 parts Ongoing Mature
★Main Ship: FrostSup ★Side ships: GlaSori, SopGen [And, All the other ships from Bonded By Fate, 1st generation] The sun rises from the horizon. The unfurling covers of book, seems to have a new tale to be brought upon. A tale of an unknown fate, eager to seek it's new existence in the new generation. Bonded by Fate 2.. A huge secret behind, brought the two heirs, Frostfire and Supra, together by their own kingdoms, under the bond of an "arrange marriage" and there began the story that was nurtured by misconception and uncountable heartbreaks. The unanswered hints of previous era, uncovered gradually, unveiling lingering secrets within. The unknown promise of danger spoke with confidence, eager to destroy the foundation of love, and sow terror within the hearts of Thunderstorm and Ezekiel dynasty. "𝘠𝘰𝘶. You will never know the rage of a mother, until you go through that pain 𝘺𝘰𝘶𝘳𝘴𝘦𝘭𝘧. I will make sure, when I leave, I'll leave with a triumphant smile on my face.." ★All the characters used in this fiction, belong to Monsta. This fiction is made only for fun purpose. Credits to Monsta. ✧༺Contains/Trigger༻✧ -OmegaVerse -Mediaeval era -Mature, 🔞18+ Scenes🔞, Male X Male. -Gore, Black magic, Horror, Action, Thriller. -Love, Fantasy, Drama, Heavy Angst -Arrange Marriage ★Story writers and directors: @Mochi_SolSol @Lavenderdreamthings ★Story editor: @Mochi_SolSol
The Orphan Network by codydraco
1 part Complete
Danny's life takes a drastic turn when after running away from his broken home he stumbles into a secretive network dedicated to aiding those betrayed by society. As he becomes entangled in their hidden world, he discovers a group bound not just by their mission but also by their harrowing pasts. When Oskar, a key member of this network, vanishes, Danny and Ellis-the de facto leader of the group-develop feelings for each other as they are thrust into a perilous search. Their quest to find Oskar exposes deep-seated traumas and hidden truths about themselves. As they navigate the dangerous terrain of betrayal and threat, they confront a nefarious local gang known as The Remnants, who are not only endangering their hidden community but also holding an innocent girl named Esme captive. With trust wavering and tensions mounting, Danny and Ellis must confront their own demons and determine how far they are willing to go to save their friends and protect their found family. The inclusion of housemate Ashley's retired police officer uncle Doug raises the stakes tremendously. Will they be able to save Esme without exposing their entire at-risk community to outside scrutiny? In "The Orphan Network", suspense and emotional depth converge in a gripping tale of newfound fragile love, gritty survival, and essential trust.
The Bind by MaierCowan
25 parts Complete Mature
I may have been an owl, but my heart was a hummingbird, and it's wings beat frantically against the cage of my ribs as the forest disappeared beneath snowy wings. Dry updrafts carrying burned out leaves, shriveled by the first heatwave of the year, did not help with the comparison my mind was drawing with the sinking feeling of descending into hell. "Becky I don't know if I can do this." I linked the alpha wolf guiding me through the maelstrom of introducing myself to my pack. My pack? I was still wrapping my head around being a wolf, let alone being in possession of over a hundred of them. "Sure you can. You claimed them. Given their recent history, without your new leadership their pack will be decimated by the Elders." She didn't like them. I didn't like them. They didn't like me. They were dousing the back of my mind with death threats. What could go wrong? ... The Bind is the third novella revolving around Claire Menzies journey into a violent, seductive shadow world. A world where were creatures live alongside normies, and are governed by animal instinct and mystery.
You may also like
Slide 1 of 9
Shattered Hearts cover
His Addiction {COMPLETED} cover
Vitality (Vitality Series #1) cover
The Only Queen cover
Burn Me Right cover
(Blood Bound)Eternal Winter cover
Bonded By Fate [2nd Generation]: What Are We? cover
The Orphan Network cover
The Bind cover

Shattered Hearts

13 parts Ongoing Mature

"Are you French? Because Eiffel for you." I say to her. She laughs. I can't even explain how my much I love her breathtaking taking laugh. The way her eyes squirt at the corners. Her nose scrunches up just a little bit. A light pink blush spreads across her face. She is perfect. I think it goes without question. I love her. Avyanna: a friendly, pretty,and smart girl. She will do anything to achieve her dreams. While continuously fighting the demons of her past. Grey: A handsome, smart, and athletic boy. Still mourning the loss of his late brother, he is moved to a new city. Starting over again. Avyanna and Grey have both suffered from a terrible past. They both struggle with opening and expressing their emotions to others. When their journalism teacher pairs them together for a writing assignment about one another, they become acquaintances. Will this lead to something bigger? And most importantly will they find solace in one another?

More details