An Experience
Originalfox
  • Reads 20
  • Votes 6
  • Parts 21
  • Time 4h 53m
  • Reads 20
  • Votes 6
  • Parts 21
  • Time 4h 53m
Originalfox
Ongoing, First published Feb 15, 2021
Mature
animalscolddarkdarkfantasydarklovedarkmagicfantasyganglifegangshorrorhorror-thrillerlgbtlgbt-themedlgbtfictionlgbtlovelgbtpridemafiamurdermysterywerebeastwerewolfwinter
Avilion is young. After it's birth known as the Great Collision, the survivors of its destruction worked to rebuild the life they knew before, with a few biological changes.

Autumn DuPond was born into this world, all they've ever known is the frozen half of Avilion, while all they've ever known about the other half is that it's on fire. Sheltered, blind to the world around them, and alone since the moment of birth Autumn just wants to get out of the cruel city they've grown up in. When their wish is granted... They get a little more than they asked for.

Thrust into a world of lies, corruption, mafia families, death, and werebeasts, Autumn finally gets their glimpse of the world they've been desperate to experience... However, they may not be prepared for how dark it really is.
All Rights Reserved
animalscolddarkdarkfantasydarklovedarkmagicfantasyganglifegangshorrorhorror-thrillerlgbtlgbt-themedlgbtfictionlgbtlovelgbtpridemafiamurdermysterywerebeastwerewolfwinter
Table of contents

21 parts

Sign up to add An Experience to your library and receive updates
or
Content Guidelines
You may also like
The Lost King: The New Pack by ChinaKing6
33 parts Complete Mature
Growing up in foster care never knowing who his real parents are or where he comes from has always been hard for Kason especially with his mind and body going through weird changes. He has been hearing voices in his head since he was a boy. Being afraid of being looked at like a crazy person he keeps it to Himself only speaking on it with the women closet to his heart. Little do he know he's not going crazy and those voices are never going to go away.... Then there's Sasha, growing up spoiled she thought she had the world figured out. With her parents hiding a serious secret from her and feeling rebellious she sets out on her own path in life. Thinking she found the love of her life she leaves home after a big blow up between her and her parents. Little doesn't she know she's With a wolf in sheeps clothing. She unfortunately had to learn the hard way everybody who say they love you really do. Fate has a way of bringing people together, what happens when these two paths cross. More importantly what happens when they find out They were made for each other. Will the fall for each other or is this a disaster waiting to happen? Follow Kason and Sasha on their journey to find family, love and most importantly themselves....... Mature content 18+ to read Started 11/12/17
(Blood Bound)Eternal Winter by hedgienab
13 parts Complete Mature
Please Note, I'm thinking of changing the title from Blood Bound to Eternal Winter, or even something else. Any ideas, feel free to inbox me! "You're a monster.." His teeth were gritted, eyes wide. I shrugged, "Maybe, but I'm your monster." Greyson Black's girlfriend died months ago, leaving him half a person. Until he catches a case that follows him home. This story contains one rather explicit sex scene which I may take out and put in a new section all its own. Chapters are long even though there aren't many.
The Only Queen by ladyrose_thewriter
38 parts Complete Mature
[MAFIA ROMANCE, RATED R] "I catch a lot of attention these days," she purred, her voice dripping with seductive allure as she toyed with Cedric's expectations. "But you haven't quite managed to capture mine yet," she teased, her tone coy yet tantalizing. Cedric's expression darkened slightly, a predatory gleam in his eyes as he stepped closer to Lilith, the air charged with electricity between them. "I always get what I want, when I want," he growled softly, his voice low and commanding as he locked eyes with her. ~ In the heart of the male-dominated underworld, Lilith emerges as a formidable force, crowned as the sole queen among her four brothers. It's a destiny written before her birth, a path she must walk to uphold her family's legacy. Tasked by her oldest brother, Lucifer, with using her feminine charm to navigate the treacherous world of organized crime, Lilith finds herself entangled in a web of intrigue, unaware of the intricate game Lucifer is playing. Sin City is akin to hell itself, a domain where Lucifer holds sway, and Lilith is destined to become the Queen of Hell. As Lilith embraces her role, her journey collides with Cedric, an ambitious underworld king ruling the streets of New York. Cedric is determined to make Lilith his queen, regardless of the consequences. Their meeting ignites a fierce clash of wills and desires, propelling them into a whirlwind adventure through the dangerous streets of Sin City and New York. Bound by duty to fulfill her family's legacy by producing an heir, and Cedric's need for a queen to reign over New York, their attraction becomes undeniable. Yet, they must navigate the complexities of their forbidden love, determined to find a way to make it work against all odds, even as the powers of hell itself watch their every move.
Bonded By Fate [2nd Generation]: What Are We? by Mochi_SolSol
13 parts Ongoing Mature
★Main Ship: FrostSup ★Side ships: GlaSori, SopGen [And, All the other ships from Bonded By Fate, 1st generation] The sun rises from the horizon. The unfurling covers of book, seems to have a new tale to be brought upon. A tale of an unknown fate, eager to seek it's new existence in the new generation. Bonded by Fate 2.. A huge secret behind, brought the two heirs, Frostfire and Supra, together by their own kingdoms, under the bond of an "arrange marriage" and there began the story that was nurtured by misconception and uncountable heartbreaks. The unanswered hints of previous era, uncovered gradually, unveiling lingering secrets within. The unknown promise of danger spoke with confidence, eager to destroy the foundation of love, and sow terror within the hearts of Thunderstorm and Ezekiel dynasty. "𝘠𝘰𝘶. You will never know the rage of a mother, until you go through that pain 𝘺𝘰𝘶𝘳𝘴𝘦𝘭𝘧. I will make sure, when I leave, I'll leave with a triumphant smile on my face.." ★All the characters used in this fiction, belong to Monsta. This fiction is made only for fun purpose. Credits to Monsta. ✧༺Contains/Trigger༻✧ -OmegaVerse -Mediaeval era -Mature, 🔞18+ Scenes🔞, Male X Male. -Gore, Black magic, Horror, Action, Thriller. -Love, Fantasy, Drama, Heavy Angst -Arrange Marriage ★Story writers and directors: @Mochi_SolSol @Lavenderdreamthings ★Story editor: @Mochi_SolSol
THE VISION:Love of dragonphoenix by buddyphoneix
9 parts Ongoing Mature
A story of two souls who died in the battle of achieving their love..These two souls are wandering in the sky, waiting to become one again..!! A story of a secret agent team who eradicate bad from nation....Their reincarnation's, helping the nation,This time will they win their lovebattle over the evil,bad....??this time......
You Will Get It Back by satakshi14
26 parts Complete Mature
Stella has seen a lot in her life. After her parent's death, Everyone blamed her for everything and tortured her mercilessly.When she needed someone, people mistreated her and to make it even more worse her mate rejected her. But as the saying goes, 'That what doesn't kills you makes you stronger'. So here she is a strong but dark soul.She thinks that she can carve her ways and decide her own destiny but no matter what. Destiny always finds it's way. Stella decides to run away from her old back a later take her revenge unaware of what future holds for her. But everything changes when she finds out who she really is and all she is left with is her long-lost brother, a killer mate, a dangerous sister, a few heartbreaking secrets and a humorous faith Follow Stella in her breathtaking journey and see how does she manages to get out of this mess........... UNEDITED STUFF, SO YOU MAY FIND GRAMMATICAL MISTAKES PLEASE DON'T MIND THEM CAUSE I AM STILL EDITING THIS STORY.
Vitality (Vitality Series #1) by Crysta_levere_author
67 parts Complete Mature
A violent passion. A dangerous bond. A nightmare that will change everything. To Ava, love is about as real as fairytales. But it might be that fairytales, myths, and magic have some truth to them after all - as well as the monsters that lie in the shadows. Or she could just be completely out of her mind. After a mental breakdown and a move to a new town, everything changes when Ava clashes with a stranger with eyes as black as midnight and a terrifying sinister air. Her wishes to feel something again become granted. But Ava soon learns that not only is he as cold as he is beautiful, but he brings something out of her, stronger than ever, like fuel to fire - something she's desperate to bury. He haunts her dreams and waking life, and staying away becomes harder than she could have ever imagined, risking her life, her humanity, and the people that she cares about. Not to mention the fate of the world. She's fighting for life. He's fighting for death. What does it take to live? What does it take to love?
Her Tyrant Alpha [EXCERPT] by ESHurricane
6 parts Complete Mature
*Available in full on Radish or Patreon!* She was born in fire. He was forged in ice. The clash will scorch them both. After a disease wipes out all human life on earth, the world is left to the werewolves. As packs organize and claim territory, an opportunity arises to collect information from a Viking pack headed by the dangerous alpha, Nolan Frosaker. Ashelin jumps at the chance to go undercover, but only partly because she wants to contribute to the mission. The Viking King intrigues her, and she has unique talents that will get her close to him. What she doesn't anticipate is Nolan's own unique talents, and how quickly she desires to be completely at his mercy. Warnings: This story is rated mature for a reason. Rated NC-17 for very intense bdsm power play in an environment that wouldn't be safe if it were humans not in fiction. NOTE: This story takes place in the Bloodlines universe, but can be read as a standalone. If you're curious about the apocalypse and want more of Ashelin and her previous pack, check out Bloodlines Vol. 1 for the first entry in that series and info on reading the rest!
The Little Sacrifice by VTBonds
2 parts Complete Mature
Desperate for the Demon's lair. For a love never meant to be, our bond thrives despite my weakness. I fight for love, knowing more than my own life is at stake. I'll protect what's mine with every breath. No matter the cost. *This Dark Omegaverse Romance is not for the faint of heart. If explicit scenes, violence, and D/s themes offend you, please abstain. Proceed with caution.* *THIS IS AN EXTENDED SAMPLE.* Get an exclusive 50% off e-book retailer prices when you use code WATTPAD on https://vtbonds.com. Visit my website and use code WATTPAD for 50% off retailer prices on all e-books. You'll also find signed paperbacks, discounted audiobooks, and swag packs! Sign up for my newsletter (link on website) and enjoy free and filthy Bonus Scenes, coloring pages, and NSFW artwork. Knotty reading!
You may also like
Slide 1 of 9
The Lost King: The New Pack cover
(Blood Bound)Eternal Winter cover
The Only Queen cover
Bonded By Fate [2nd Generation]: What Are We? cover
THE VISION:Love of dragonphoenix cover
You Will Get It Back cover
Vitality (Vitality Series #1) cover
Her Tyrant Alpha [EXCERPT] cover
The Little Sacrifice cover

The Lost King: The New Pack

33 parts Complete Mature

Growing up in foster care never knowing who his real parents are or where he comes from has always been hard for Kason especially with his mind and body going through weird changes. He has been hearing voices in his head since he was a boy. Being afraid of being looked at like a crazy person he keeps it to Himself only speaking on it with the women closet to his heart. Little do he know he's not going crazy and those voices are never going to go away.... Then there's Sasha, growing up spoiled she thought she had the world figured out. With her parents hiding a serious secret from her and feeling rebellious she sets out on her own path in life. Thinking she found the love of her life she leaves home after a big blow up between her and her parents. Little doesn't she know she's With a wolf in sheeps clothing. She unfortunately had to learn the hard way everybody who say they love you really do. Fate has a way of bringing people together, what happens when these two paths cross. More importantly what happens when they find out They were made for each other. Will the fall for each other or is this a disaster waiting to happen? Follow Kason and Sasha on their journey to find family, love and most importantly themselves....... Mature content 18+ to read Started 11/12/17

More details