Mr. De Luca [ON HOLD]
submissiveB
  • Reads 12,442
  • Votes 756
  • Parts 24
  • Time 3h 23m
  • Reads 12,442
  • Votes 756
  • Parts 24
  • Time 3h 23m
submissiveB
Ongoing, First published Feb 25, 2021
Mature
18plusabductionaction-romanceamadloziancestorsbwwmfamilyinterracialitalianmafiapossessiveromancezulu
⚠️⚠️Trigger Warning⚠️⚠️

Rated 18
~~~~~~
"It is good to see you again, il mio amore." He says as he kiss the back of her hand which smells like honey and coconut. He helps her out of her coat and sees how her dress clings to her body which leaves him awestruck. He pulls out her chair and helps her push it in.
~~~~~~


~~~~~~
This book is a work of fiction. The names, characters, places and incidents are the products of the writers imagination and are not to be constructed as real. Any resemblance to persons, living or passed on, actual events, locals, businesses or organisations is coincidental.
All Rights Reserved
18plusabductionaction-romanceamadloziancestorsbwwmfamilyinterracialitalianmafiapossessiveromancezulu
Table of contents

24 parts

Sign up to add Mr. De Luca [ON HOLD] to your library and receive updates
or
Content Guidelines
You may also like
Fire And Ice (Lost&Found Series)✔ by swritess1
79 parts Complete Mature
53 Chapters. (Completed) I pushed her back and she landed on the bed with a slight bounce. She swallowed hard and her right hand shot up to her stomach. My eyes watched her every movement as if she was my prey. I knew for a fact that she was now equally scared and nervous. I slowly made my way towards the bed and parted her legs with my knee, hovering above her. "I suggest you watch that mouth around me." I spat. Her breath hitched as our faces were now only a centimeter apart. Without giving it much thought, I leaned in and captured her lips in a bruising kiss. STARTING DATE: 01/06/2019 ENDING DATE: 10/22/2019
NO DOUBT [bwwm] by bunnygirlsenpaistwin
42 parts Complete Mature
『 𝙉𝙊 𝘿𝙊𝙐𝘽𝙏 』 What happens when a 22-year old lands a job in a restaurant, and meets the owner's son. Excerpt from book: 《 His voice was low, raspy, laced with something of desire, maybe, but all I could hear was lust of the most unchaste kind. "You know, you drive me crazy,... so fucking insane. And it might just be my madness talking, but I have a feeling you want me." He approached, closing the gap between our two bodies. I tried taking a step back, but only felt the cold kitchen counter against my warm trembling palms. "Do you want me, dolcezza?" He whispered against my ear as his hands found their way to my waist. The heat between my legs was insufferable, and my pounding heart drummed against the walls of my chest. In my head, it was clear, I wanted him, but him, of all people? He lowered his hands to my hips and pulled me impossibly closer to him. I let out a shaky breath, that came out as a soft moan. Shit. "Then be a good girl, and say it." 》 ❦❦❦ Read trigger warnings first. I do NOT own any of the pictures or the music displayed in this book. Highest rankings: #1 in blackwoman #1 in trend #1 in slowburn #1 in forbidden #1 in trending #1 in blackgirl #1 in vote
ZARA by zarapier
79 parts Complete Mature
BOOK 3 OF THE DE'MARCO SERIES. This book is a part of a series, but can be read as a standalone, please read the last paragraph for detailss. •••••••••••••••• This book is another one of my cliche fantasies brought to life. Zara King is an independent, confident 21 year old. She likes to put up a strong front but she's sensitive and just wants to feel as protected as her dad made her feel again. Christiano De'Marco is the Italian Mob-Bosses brother. He's the definition of a badboy. He's the CEO of De'Marco Enterprises, the mafias cover business, and he can be described as arrogant, player and unbothered about peoples feelings... most of the time. ********************* All pictures used are from pinterest, i dont claim credit for any of them. PLEASE READ THE ENTIRE DESCRIPTION BEFORE READING ANY OF MY BOOKS. If i have used your material and you want me to either remove it, or give you credit, please let me know and id be happy to. ********************* ●●●●●●●●● The book DOES NOT HAVE any smut. It is marked mature because of language. ●●●●●●●●● hii. This is the third book in the De'Marco family books. It can be read as a standalone, This book does have references to both PICCOLO BAMBINO INGUENUO and LA MIA MELODIA, which are my first two books, and would be kind of like a continuation i guess, but its a story on its own, any references that i do put ill explain, but if you wanna get the full experience then id recommend you do read it. Oki enjoy muah.
The Mafia's Queen by xowhiterose
40 parts Complete Mature
Two people from completely opposite worlds collide in an odd turn of events. Opposites are said to attract and this is no exception. He was not perfect nor was he a saint. She however was as soft as a flower and as bright as the sun. The paradigm of perfection and he wants her as his queen and not just because of her goddess like features but for her heart and soul that are as sweet as candy. She is a spit fire at first but a sweetheart in the end and she was the Mafia's Queen. ~ Excerpt: She was perfect in his eyes. A ray of sun in a world of dark. The look he was giving her from across the room was the look every girl yearns for from a man. Staring at her he saw his queen...His world. ~ Prequel of The Mafia Saved Me but can be read as a stand alone story!! This is the story of Leo Bandoni's father and mother
Prisoner to Mr. Mafia (Book 1 In PTMM Series) by shania_nia
35 parts Complete Mature
"Il Mio Amore, wait and see what I have planned for you." Adriano said with a smirk that made my stomach churn. All I could do was turn my head away from his glaring cold eyes and pray that my father would come for me soon. My name is Gianna Alexeev and I am the daughter of the Russian Mafia boss. I grew up knowing the hard life of being in this particular "family business" and I absolutely hated every minute of it. When you think of the name Adriano Basilio you think of ruthless, cold-hearted, killer, murderer, merciless, cruel, heartless, callous, unlovable...etc. He is the boss of the entire U.S. Mafia business. He was the Capo di Capi. Boss of all Bosses. And he was my kidnapper. [THIS BOOK IS FOR 17+. IT HOLDS MATURE CONTENT. READ AT YOUR OWN RISK!! INCLUDES: SEX, FOUL LANGUAGE, & VIOLENCE]
Twist of Fate by siphosethumaya
81 parts Complete Mature
Lisa: W-what a-re you...what are y-you doing? She stutters as he pulls her even closer to him. Balancing herself, she puts her hands on his shoulders while looking up at him as he smirks seeing how flustered she looks but he doesn't miss the fear in those grey eyes that leave him speechless everytime he looks at them. Snakes: I'll come back for you. Lisa can't even respond as he kisses her, she kisses him back but pulls away almost immediately, she pushes him away. She can't believe she just kissed another man who isn't James in their home. She doesn't even know him. He smirks and grazes his finger on his lips while looking at her. Snakes: Next time I kiss you, you won't be pulling back.
His Little Amore by Winter____princess
36 parts Ongoing Mature
ITALIAN x INDIAN What will happen when two strangers who are completely different from each other come face to face? One is darkness and the other is light. One is cruel and the other is kind. One is fire and the other is water. One is a scary night and the other is a hopeful morning. One is a devil and the other is an angel. " Non puoi scappare da me... MIO PICCOLO AMORE. Non importa quanto scappi da me, alla fine rimarrai intrappolato tra le mie braccia per sempre." He said while looking at her. who is unconsciously lying on his bed. A cute love story about a Italian hidden mafia and a normal Indian girl who is unknown by the cruel world. WARNING ⚠️ 1. English isn't my first language so I can make mistakes and also it's my first time writing a story. So kindly ignore the grammatical mistakes. 2. Don't copy my story. 3. If you don't like my story you can simply leave it. But please don't give any hate to my story. 4. This story doesn't have any sexual content, it's just a cute and pure love story. 5. This story is completely based on fiction and has nothing to do with reality. Like this story, its characters are also fictional.
Beautiful in Jada by KindaWerid
26 parts Complete Mature
The strong pull to her. The desire to have something you never thought you would want again. A glance turned into an obsession. And he would stop at nothing to get her. He would do anything he could to keep her. He cared so much for only her Alessio Bucceri was a man who could have anything he ever wanted. Until he wanted that one thing to need him back. Circumstances run in his favor as the woman of his dreams landed into his domain. He would never let her go. A chance glance turned obsession. #1 BWWN! #1 Mafia [4/12/24] *Book excerpt* -- Her cheeks turned red, ever so slightly through her chocolate skin. Her skin looked and felt so smooth. She liked the compliments, the Italian flare. It ropes many women, but the way she looked at me with her big almond eyes had my mind racing and my body in overdrive. She was not immune to my charm, even in her current situation. Her hair was in a slick bun. I was sad not to be able to see the curls adorne her face. And yet she stared at me again, watching me like a dog. Curious gazes. It was fun to tease, and the response I got back over affirmed my teasing. She seemed more relaxed with me. She looked away from me. She stared out the window watching the street ride by. It was silent for a while as I texted my subordinates basic commands. Nothing conspicuous. "Alessio, where are you taking me," her voice piped up. Seems like it took her a while to muster up the courage. I loved her sweet voice when it spoke me me and when she said my name... It was such a turn-on. She wasn't supposed to really ask questions. I don't like lots of questions. I thought about the best way to respond but opted not to say anything at all. She was as stubborn as always, forgetful too. She scanned around me before huffing to herself and looking back out the window. -- Started 06/08/2023- 8/14/2023 Highest Rankings: #7 Arranged [4/26/24] #26 Older #1 Bwwm #13 Man #1 Mafia #1 lovetragedy #6 lovestory #5 Blackwomen
Daddies Little Princess by kaybebs
38 parts Complete
"Helen Romano you're way too innocent I fear if I touch you I'll ruin you" he said and I frowned "yeah right it didn't seem like it last week when you were inside me" I fought back there was no way this guy was serious right now "Helen don't push my buttons... I'm fucking losing it" he growled and I smirked good "what are you gonna do about it daddy???" I mocked taking his hand to my waist i knew what that did to him "I'll show you" he growled and smashed his lips on mines yanking me up to him **************************************** Enzo Ricci billionare and mafia Don of the Italian mafia ruthless and smart when you meet him once wish that you never cross paths again with him. When you wrong him there is no remorse he kills without hesitation Helen Romano a South African Italian girl who works for the E.C hotels and co-operations as one of the cleaning stuff is carefree and innocent.She overcomes all her problems with a wide smile on her face even the painful heartbreak and the loss of her previous job that she had to take up cleaning what happens when she meets this devil of a CEO let's see what happens when this devil is attracted to the angel and claims her as his let's discover heartbreaking secrets and how these two overcome their challenges
𝐁𝐄𝐒𝐓𝐎𝐖𝐄𝐃 (18+) by Berries_Are_Nice
33 parts Complete Mature
THANDEKA NDABA [26] Guarded her whole life, is wed to Zweli Nkabinde, who shows his deceitfulness right before they wed but she is oblivious. As she moves to a new Kingdom, a foreign place to her, with her crush as her bodyguard. She soon finds out that life is not all what it seems and that people are not who they claim to be. QOPHELO KHUMALO [26] Molested and separated from his sister from the tender age of 11, goes on to work at the KwaNdaba Kingdom. He's oblivious to Thandeka's crush on him. He ends up winning and going to work as a bodyguard at KwaNkabinde Kingdom. He clashes with Zweli and develops a hatred for him. Qophelo is about to learn that it takes a lot more to conquer the evils of the world than just strength. _____ "Princess, I'm not forcing you to do anything you don't want." She smiled, leaned down and pecked his lips. "I know. I want to do this." He let go of her and watched her bra fall off. His breath hitched and he trailed both his hands from her waist to her delectable nipples. They dark and small but very hard. She shivered as Qophelo's thumbs grazed them. "You're so beautiful, Princess." He complemented as he wet his finger and grazed the nipple again, teasing her. _____ [ MATURE CONTENT ] (violence, death, triggers, graphic sexual scenes) [ DON'T PLAGIARISE ] [ FICTION ] _
You may also like
Slide 1 of 10
Fire And Ice (Lost&Found Series)✔ cover
NO DOUBT [bwwm] cover
ZARA cover
The Mafia's Queen cover
Prisoner to Mr. Mafia (Book 1 In PTMM Series) cover
Twist of Fate cover
His Little Amore cover
Beautiful in Jada cover
Daddies Little Princess cover
𝐁𝐄𝐒𝐓𝐎𝐖𝐄𝐃 (18+) cover

Fire And Ice (Lost&Found Series)✔

79 parts Complete Mature

53 Chapters. (Completed) I pushed her back and she landed on the bed with a slight bounce. She swallowed hard and her right hand shot up to her stomach. My eyes watched her every movement as if she was my prey. I knew for a fact that she was now equally scared and nervous. I slowly made my way towards the bed and parted her legs with my knee, hovering above her. "I suggest you watch that mouth around me." I spat. Her breath hitched as our faces were now only a centimeter apart. Without giving it much thought, I leaned in and captured her lips in a bruising kiss. STARTING DATE: 01/06/2019 ENDING DATE: 10/22/2019

More details