The Palace of Lost Memories
CjArcher
  • Reads 9,257
  • Votes 1,293
  • Parts 31
  • Time 6h 44m
  • Reads 9,257
  • Votes 1,293
  • Parts 31
  • Time 6h 44m
CjArcher
Complete, First published Mar 04, 2021
-romanceamnesiacourtepicepicfantasyfantasyfantasy-romancefantasyadventurehealerhighfantasyintriguekingmagicmedievalmysterypalaceromanceromanticromanticfantasyroyaltyswordandsorcery
The king's magnificent palace was built in a matter of weeks. No one saw the builders, no villagers are allowed beyond the gilded gate, and only one servant has ever left. The haunted look in her eyes as she was recaptured by the palace guards is something Josie, daughter of the village doctor, has never forgotten.

For Josie, the palace is a mystery that grows more intriguing after she meets the captain of the guards, a man known only as Hammer, as mysterious and captivating as the palace itself. Whispers of magic fuel Josie's desire to uncover the truth, but an ordinary girl like her can only dream of ever being invited inside.

When the king decides to take a wife from among the eligible daughters of the noble families, the palace gates are finally thrown open and the kingdom's elite pour in. In a court where old rivalries and new jealousies collide, the king's favorite is poisoned and the doctor is summoned. As her father's assistant, Josie finally sees inside the lavish walls, but she soon learns the palace won't surrender its secrets easily, for not a single resident, from the lowest servant to the king himself, has a memory from before the palace existed.

In the search for the truth, Josie is drawn deeper into danger, and the answers she seeks might shake the very foundations of the kingdom.
All Rights Reserved
-romanceamnesiacourtepicepicfantasyfantasyfantasy-romancefantasyadventurehealerhighfantasyintriguekingmagicmedievalmysterypalaceromanceromanticromanticfantasyroyaltyswordandsorcery
Table of contents

31 parts

Sign up to add The Palace of Lost Memories to your library and receive updates
or
#436fantasyadventure
Content Guidelines
You may also like
Of Blood and Duty by WhiteGoldFangs
29 parts Complete Mature
Wattpad Exclusive! Nearly beaten to death, a man wakes up in a place he does not know. Neither can he remember how he even ended up there. Waking up in the middle of a road he discovers a world of pain only to drift off into unconsciousness again. His body having been crushed and broken beyond his wildest dreams. Falling out of consciousness from the pain, he later wakes up in a bed. A new place he does not know, but being looked after by someone. A woman. Why was he in the care of this beautiful but strange person? How had he ended up in her care? Why had she taken him in and why was she and everyone else so guarded around him? Determined to make his way back home, wherever that may be, the man soon realizes that things are not as easy as he first had thought. Learning to fit in with the people who took him in at the brink of death, he learns that a war is raging between two kingdoms, and which one he belongs to, he cannot remember... if he belongs with to any of them. All he has to remind him of his life before is a sword with a crest of two lions on its pommel... and a woman named Jade who screams for him in his sleep. This is a spin off of The Prince's Choice and Hunted Queen. I recommend reading those two before this one to get the best experience possible!
His Dark Redemption by alice_estrella
29 parts Ongoing Mature
𝙱𝚘𝚘𝚔 𝚘𝚏 𝚊𝚗 𝚞𝚗𝚍𝚎𝚗𝚒𝚊𝚋𝚕𝚎 𝚙𝚘𝚜𝚜𝚎𝚜𝚜𝚒𝚘𝚗 "𝑌𝑜𝑢 𝑐𝑎𝑛 𝑙𝑖𝑒 𝑡𝑜 𝑦𝑜𝑢𝑟𝑠𝑒𝑙𝑓 𝑡ℎ𝑎𝑡 𝑦𝑜𝑢'𝑟𝑒 𝑓𝑟𝑒𝑒, 𝑏𝑢𝑡 𝑖𝑛 𝑡ℎ𝑒 𝑒𝑛𝑑 𝐼'𝑙𝑙 𝑝𝑜𝑠𝑠𝑒𝑠𝑠 𝑦𝑜𝑢 𝑡ℎ𝑒 𝑤ℎ𝑜𝑙𝑒 ─ 𝑦𝑜𝑢𝑟 𝑙𝑜𝑣𝑒, 𝑦𝑜𝑢𝑟 𝑑𝑟𝑒𝑎𝑚𝑠, 𝑦𝑜𝑢𝑟 𝑓𝑒𝑎𝑟 𝑎𝑛𝑑 𝑒𝑣𝑒𝑛 𝑦𝑜𝑢𝑟 𝑠𝑐𝑎𝑟" ✰─── ✻✻─-─✰ Living with hidden scars is a silent symphony of pain, a dance in shadows. Then, suddenly someone appears and cages you, wrapping chains around your wounded soul, turning your desire for escape into a haunting reality of confinement. ❆ In his darkened soul, her presence is an unwelcome light, yet now a haunting solace. Obsession ignites within him, a consuming flame so fierce he'd set the world ablaze, all for the chance to possess her completely, nothing matters to him not even her consent. ✴✼✴ "I hate you." she whispered Her defiance, though faint, cut through the heavy air, a final stand against the man who had just bound her life to his with twisted vows. Ekaksh heard it, but his expression remained unmoved, his obsession too deep, too dark, to be shaken by her hatred. Without hesitation, he lifted her into his arms, cradling her lifeless form as he walked toward the car. To the world, she was now his wife To her, he was nothing less than her captor. _____________ But what if someone enters their already messed up story. _________________________________________ Tropes ~Dark romance ~slow burn ~forced marriage ~forced proximity ~mafia's obsession
A Grace of Crowns | ☑ Queenkiller, Kingmaker #1 by AM-Prabeswar
80 parts Complete
❖ QUEENKILLER, KINGMAKER Book 1 ❖ Feudal Southeast-Asia filled with magic, daemons, and a royal conspiracy. This is Isla's quest for the truth, and her slow spiral into becoming her very own worst nightmare. When the gods ascended thousands of years ago, they left behind the divine gift of theurgy. Its powers still echo amongst men, but run fiercer yet in the blood of kings and queens. And one of them will stop at nothing before Isla is dead. A betrayal lures her out of refuge and into her journey home, where she must unmask her enemies before they unmask her. The theurgy that she has had to keep hidden for many years can be her greatest ally or her most lethal foil. Only her wits can guide her through the dangerous politics of the Surikh court. But amidst the plots and schemes bubbling around her, she uncovers something far more sinister than the identity of her enemies. Something that can change her entire life; indeed, entire kingdoms. ↝ this work contains violence, profanity, and sexual references ↜ ↝ Winner of Wattys 2016 HQ Love Award ↝ Winner of FANTASCI's first Chosen One ↝ Winner of The Cryptic Awards 2018 ↝ Featured in Fantasy as of 18-01-2017 ↝ Wattpad Editor's Pick January 2021
The Art of Courts and Lies (Book 1 in The Gifted Trilogy) by chlo_dance
52 parts Complete
Ice flooded my veins as the realization of who he was hit me. It must have been evident on my face because the man in front of me let out a dark laugh. "Oh dear, you didn't realize you were talking to a royal, did you darling?" he crooned. Not just any royal. Kesserian Cinis. The recently coronated king and ruler over the Ember Court. I forgot how to breathe, my mind whirring as it tried to figure out how I could have been so stupid as to let this happen. *************************************************** Wren Heatherfield is on the run. Having turned 18, she is now in danger of becoming selected for the Garner, a deadly game in which the six kings who rule over her continent take eighteen non-magical girls and make them fight for their lives. But as she tries to avoid the game by running away with her best friend and her sister, she consequently finds herself doomed to be a competitor in the 246th Garner. But the Garner isn't the only thing capable of killing her. In a castle surrounded by kings with dark powers and girls fighting for their lives, she may find that the politics of royalty can be just as deadly as their games. No one can be trusted in a palace full of monsters and, if Wren has any hopes of survival, she may have to become one herself.
Turning Nightmares Into Dreams by lee-reid
34 parts Complete
After carelessly promising to marry the king of monsters, Elle wakes up to find herself trapped in a kingdom of mythical creatures. Soon she discovers that behind the king's stern facade lies a kind heart and vulnerability. As she gets to know him better, she realizes that he can also help her confront skeletons from her past. While they delve deeper into their relationship, Elle becomes aware of other forces at play, determined to achieve their own goals at the expense of her and her future with the king. She must uncover the truth behind the people's attitude towards the monarch and unravel the secrets the king is keeping hidden from her. Time is of the essence, and Elle must find out the truth before it's too late.
Royal Secrets (Shhhh) by AzraKhanna
51 parts Ongoing Mature
It is the story of a royal family who has hidden many secrets inside this palace for centuries. There are many mysteries which are buried in the walls of this palace with those kings. Which could have ruined many generations due to their exit. This sequence continues into the 21st century, a new king now rules here, but that in itself is a puzzle. Is he really like his ancestor? What is he hiding? He is the King of Jaipur and Politician too. Recently he has been elected as the youngest MP of the country. Hearthrobe of the Youth. Great King, A good speaker, and fully capable of showing his ability in politics. But he has some secrets. ☆One sided lovestory of Rajgardh's Daasi. ☆But what about 'Him'? What is his secret that Rajgardh has been hidden safely in these four walls of the palace from the last seventeen years ? Shhhhhhhhhhhhhh......... Rana Samar Pratap Singh- Manik /Parth Samthaan Dhara Singh- Nandini/Niti Taylor Most Impressive ranking #Best Dark royal story - 1 #awards - 08-07-23 - 4 #wattpadindian - #1 - 10-08-23 #5- Manan #10 Darkstory
Unheard Whispers by _Conteur_
30 parts Ongoing
"You aren't a distraction. You can never be you know" he said looking at me with enamoured eyes. "What makes you think so? " I asked. "You are just too attractive to be a mere distraction" he said. "That's because you haven't seen my ugly inner demons." "Then what do you think you are? " his voice grows curious. "I don't know, maybe a distraction for the someone who is already attracted to something else." my voice becomes emotionless. So, what if she's a Royal when in reality she has no family to rely on. The high magnificent walls of the palace hides such truths that none could expect, and she is now hell bent to uncover those, for these are the truths that have made her life so miserable. And what happens if those who once did so wrong to her are now back to ask forgiveness and a place in her life. And now with a new identity she is back to take her rights and take account & punish everyone who have wronged her.
The Thread Of Fate by SK_tea24
60 parts Complete
"You need to understand this." He stepped closer, "I'm going to protect you Seraphina. Now and forever. Even if you choose to leave. You're someone I'm willing to die for so get it through your head." "Why?" I breathed. "Because I want to." He kissed my forehead, "and because I can." **** A king on the path of revenge and a girl running for her life. Can he protect her? Will she save him? Will they fall in love and have a happily ever after? Or does fate have other plans? **** This story is now completed 🎉 (it's the first draft though 🤫)
"LET'S GET SWAP" by InfinityThoughts8
14 parts Ongoing
"When a mysterious girl ventures into the past through a time-traveling escapade, she unexpectedly crosses paths with a strict and cold-hearted ruler, the king of an ancient Dynasty. Their encounter sets in motion a chain of revelations, unveiling numerous surprises and long-concealed secrets that promise to reshape their world.As the story unfolds, the girl and the ruler embark on an unpredictable journey, both drawn together by a force they can't comprehend. The path ahead is shrouded in mystery, leaving them to wonder where this extraordinary adventurous journey will ultimately lead them, and what new challenges and discoveries await." What will happen? Read it now to find out and know more about the whole story.
You may also like
Slide 1 of 9
Of Blood and Duty cover
His Dark Redemption cover
A Grace of Crowns | ☑ Queenkiller, Kingmaker #1 cover
The Art of Courts and Lies (Book 1 in The Gifted Trilogy) cover
Turning Nightmares Into Dreams cover
Royal Secrets (Shhhh) cover
Unheard Whispers cover
The Thread Of Fate cover
"LET'S GET SWAP" cover

Of Blood and Duty

29 parts Complete Mature

Wattpad Exclusive! Nearly beaten to death, a man wakes up in a place he does not know. Neither can he remember how he even ended up there. Waking up in the middle of a road he discovers a world of pain only to drift off into unconsciousness again. His body having been crushed and broken beyond his wildest dreams. Falling out of consciousness from the pain, he later wakes up in a bed. A new place he does not know, but being looked after by someone. A woman. Why was he in the care of this beautiful but strange person? How had he ended up in her care? Why had she taken him in and why was she and everyone else so guarded around him? Determined to make his way back home, wherever that may be, the man soon realizes that things are not as easy as he first had thought. Learning to fit in with the people who took him in at the brink of death, he learns that a war is raging between two kingdoms, and which one he belongs to, he cannot remember... if he belongs with to any of them. All he has to remind him of his life before is a sword with a crest of two lions on its pommel... and a woman named Jade who screams for him in his sleep. This is a spin off of The Prince's Choice and Hunted Queen. I recommend reading those two before this one to get the best experience possible!

More details