Story cover for Tmr/tw crossover by Bigbootyjudysbitch
Tmr/tw crossover
Bigbootyjudysbitch
  • WpView
    MGA BUMASA 5,618
  • WpVote
    Mga Boto 83
  • WpPart
    Mga Parte 8
  • WpHistory
    Oras 32m
  • WpView
    MGA BUMASA 5,618
  • WpVote
    Mga Boto 83
  • WpPart
    Mga Parte 8
  • WpHistory
    Oras 32m
Bigbootyjudysbitch
Ongoing, Unang na-publish Apr 06, 2021
arisarisxminhobrendabrendanteresacrossoverfrypangallyharriettisaaclaheykirayukimuraliamdunbarlydiamartinmaliatateminhominrisnewtnewtmasscottmcallscotttmccallsonyastilesstilinskiteresathomastmrtw
I'm really really bad at these but umm like there's newtmas and minris so like do I need to explain also this is probably gonna suck also there's going to be cursing sorry anyway please read the first chapter that explains everything and everybody so bye now go read✨✨🤠

( IM EDITING THIS STORY)

Newt x Thomas/stiles 
Aris x Minho 
Frypan x Lydia 
Brenda x Teresa 
Harriet x sonyo 
Jorge x Peter 
Erica x Boyd 
Scott x Isaac 
Kira x malia
Jackson x Ethan

The single as a Pringle peeps are
Derek
Liam
Gally


Also aiden died yes I know I'm mean but oh well also teresa never betrayed them and newt got the cure in  time
Public Domain
arisarisxminhobrendabrendanteresacrossoverfrypangallyharriettisaaclaheykirayukimuraliamdunbarlydiamartinmaliatateminhominrisnewtnewtmasscottmcallscotttmccallsonyastilesstilinskiteresathomastmrtw
Table of contents

8 parte

Sign up to add Tmr/tw crossover to your library and receive updates
o
#161scotttmccall
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
³ 𝐟𝐞𝐚𝐫 𝐨𝐧 𝐟𝐢𝐫𝐞 -̶ 𝘵𝘩𝘰𝘮𝘢𝘴 ni -voidtrina
25 parte Kumpleto Mature
𝐅𝐄𝐀𝐑 𝐎𝐍 𝐅𝐈𝐑𝐄 | ❝ ʜᴏʟᴅ ᴏɴ ғᴏʀ ᴅᴇᴀʀ ʟɪғᴇ, ᴜɴᴛɪʟ ɪᴛs ᴀʟʟ ɢᴏɴᴇ, ᴡᴇ'ʟʟ ᴄᴏᴍᴇ ᴀʟɪᴠᴇ, ᴀɴᴅ sᴇᴛ ғᴇᴀʀ ᴏɴ ғɪʀᴇ, ᴡᴇ'ʟʟ sᴇᴛ ғ ᴇ ᴀ ʀ ᴏɴ ғ ɪ ʀ ᴇ ❞ when sage's and thomas' relationship gets tested, hearts get broken, blood gets spilled, tears fall, and time starts to run out while trying to save a certain glader from the dangers of WICKED. - 𝘵𝘩𝘦 𝘮𝘢𝘻𝘦 𝘳𝘶𝘯𝘯𝘦𝘳 𝘵𝘩𝘦 𝘥𝘦𝘢𝘵𝘩 𝘤𝘶𝘳𝘦 : 𝘵𝘩𝘰𝘮𝘢𝘴 - 𝘣𝘰𝘰𝘬 3 𝘰𝘧 3 ( ✗ ) - unedited ( ✓ ) - edited [completed & unedited] © -voidtrina2019
• The Maze Runner: The New Beginning • ni readerishere0
12 parte Kumpleto
• After WCKD killed Newt, Thomas and the rest of the survivors a- But did the Glue really die? • A little bit Newtmas fanfic. For those who want Newt back. I want that too so, here it is! #bringingnewtback (Some characters belong to James Dashner) • the story and cover by @readerishere • • ~3rd of january 2019 : this is the reason why i downloaded wattpad in first place and i love this story with my whole heart even though its a bit cringe xd~ •
• The New One • ni readerishere0
17 parte Kumpleto
• Thomas is a new student in Southway High School. His life is boring, until the new boy, Newt, comes to his class. [Newtmas fanfic] • story and cover by @readerishere0 • • ~2019: thank you so much for the constant support and votes and inspiring comments! i cant thank you enough!! <3 in the last chapter i thanked you for 600+ reads but now were at 2,42k (i keep updating this jesus cHriSt) like hOw???~ •
Glader Girl ni PhillyReader
25 parte Kumpleto Mature
*Points at Gally* I LOVE HIM, YOUR HONOR! Gally does NOT get enough love, I stg, SMH. Plot: The first girl wasn't Theresa, it was me. I came up in the box, injured, with no memory, a necklace I don't recognize, and no trust for any of the boys around me. Except him. A Gally ship-fanfic. I try to blend both the books and the movies together, so it does follow the plot, but that isn't till waaaaaay later. This will all be one book. **Character notes: Gally- If you look up the WICKED files on Gally, it says he has Alpha tendencies, but I like movie Gally better, so that's how he'll be acting. There might be some dom. instances here and there, but they won't make up 100% of his personality. Newt- I AM A NEWTMAS SHIPPER, *FUCK YOU THERESA* But for plot, he has an attraction for the MC. It's nothing crazy, but it's relevant b/c I love the little cinnamon roll too. Alby & Minho- Again, I like the movie version of the characters, so the Gladers aren't assess lol.
Discoveries | TMR | Three ni -doubleshotofv0dka-
63 parte Ongoing Mature
"Immune doesn't mean immortal" TW: Mention of abuse, self harm, suicide, death, sex. ***This is NOT a Newt fic*** ** All credits go to James Dashner! I only own a few self-made characters ** Started - December, 2022 First chapter published - 14th June, 2023 Last chapter published - TBC #4 in thomastmr - 28th June, 2023 #2 in thescorch - 29th April, 2024 #2 in gladers - 5th September, 2025
no regrets | harriet - tmr ni 1980STEACUP
46 mga parte Kumpleto
there's only one place beatrice has ever been able to call home - WICKED. but after finding out they weren't who she thought they were she escapes into something that puts her into more danger. the scorch. now she is stuck with a group of people she barely knows trying to find a place she is not sure even exists. chuck in some strange dreams and cranks and beatrice starts to feel herself spiralling out of control. but falling for someone was something she never expected to happen. harriet x female oc disclaimer: all the characters apart from my oc and some plots belong to james dashner and wes ball. this story follows the film storyline. this story is set in tst, tdc and the 6 month period in-between tst and tdc. highest rankings: #1 in harriet #1 in kayascodelario #1 in tst #1 in thescorchtrials #1 in aris #1 in thomasmazerunner #3 in minhomazerunner #3 in thomas #6 in thedeathcure #7 in newtmazerunner started: 28th march 2021 finished: 22nd november 2021
Subject X1- The Leader (Non Edited) ni somewherenothere
26 mga parte Kumpleto
"𝑇ℎ𝑒 𝑚𝑎𝑧𝑒 𝑤𝑎𝑠 𝑗𝑢𝑠𝑡 𝑡ℎ𝑒 𝑏𝑒𝑔𝑖𝑛𝑛𝑖𝑛𝑔" ♡︎ Subject X1 also known as Violet was affected by the flare, not as others were affected. Sure she was sick, but shortly after she developed inhuman abilities after being in contact with the virus. She was later kidnapped by WICKED at a young age and brought to its lab to get tested on. Shes hardly ever talked to anyone instead staying in her room locked up only going out to eat. While eating she stumbles on a boy named Aris who promises that with her help he'll get her out. *Newt X OC* BOOK 1
the maze runner preferences and imagines ni c_leclerc_c
17 parte Kumpleto
the title says people in this story newt, thomas, minho, gally, aris, winston, frypan, jorge, brenda, sonya, harriet, teresa if i forgot someone please tell me in the comments
Together Again // newtmas ni bloody_halfblood
15 parte Kumpleto
This is a newtmas story. It takes place in the safe haven 1 month after they escape W.I.C.K.E.D. Thomas is blaming himself for Newt's death, and no one can seem to cheer him up. So what happens when they find out that Newt isn't as dead as they thought. The ships in this story are: Thomas x Newt Brenda x Gally Sonya x Minho Harriet x Frypan Clint x Aris
Fingerprints ni Fairylights4672
40 parte Kumpleto
Newt has had many detective partners over the years. Some have been too bossy. Some too stupid. Some too arrogant. Some too touchy. And now he has a new one, and he's just hoping they'll be a little better than the ones before him. Thomas is happy to have lots of different partners. They always bring something new to the table, made it interesting. And now he's excited to have a new one. But, something more serious than their pretty squabbles and teasing will arise, and they must work together to figure out what's going on, and stop it before it blows out of their control.
Magugustuhan mo rin ang
Slide 1 of 10
³ 𝐟𝐞𝐚𝐫 𝐨𝐧 𝐟𝐢𝐫𝐞 -̶ 𝘵𝘩𝘰𝘮𝘢𝘴 cover
• The Maze Runner: The New Beginning • cover
• The New One • cover
Glader Girl cover
Discoveries | TMR | Three cover
no regrets | harriet - tmr cover
Subject X1- The Leader (Non Edited) cover
the maze runner preferences and imagines cover
Together Again // newtmas cover
Fingerprints cover

³ 𝐟𝐞𝐚𝐫 𝐨𝐧 𝐟𝐢𝐫𝐞 -̶ 𝘵𝘩𝘰𝘮𝘢𝘴

25 parte Kumpleto Mature

𝐅𝐄𝐀𝐑 𝐎𝐍 𝐅𝐈𝐑𝐄 | ❝ ʜᴏʟᴅ ᴏɴ ғᴏʀ ᴅᴇᴀʀ ʟɪғᴇ, ᴜɴᴛɪʟ ɪᴛs ᴀʟʟ ɢᴏɴᴇ, ᴡᴇ'ʟʟ ᴄᴏᴍᴇ ᴀʟɪᴠᴇ, ᴀɴᴅ sᴇᴛ ғᴇᴀʀ ᴏɴ ғɪʀᴇ, ᴡᴇ'ʟʟ sᴇᴛ ғ ᴇ ᴀ ʀ ᴏɴ ғ ɪ ʀ ᴇ ❞ when sage's and thomas' relationship gets tested, hearts get broken, blood gets spilled, tears fall, and time starts to run out while trying to save a certain glader from the dangers of WICKED. - 𝘵𝘩𝘦 𝘮𝘢𝘻𝘦 𝘳𝘶𝘯𝘯𝘦𝘳 𝘵𝘩𝘦 𝘥𝘦𝘢𝘵𝘩 𝘤𝘶𝘳𝘦 : 𝘵𝘩𝘰𝘮𝘢𝘴 - 𝘣𝘰𝘰𝘬 3 𝘰𝘧 3 ( ✗ ) - unedited ( ✓ ) - edited [completed & unedited] © -voidtrina2019

Karagdagang detalye