Trinity
cyborgladiator
  • Reads 1,592
  • Votes 136
  • Parts 14
  • Time 2h 13m
  • Reads 1,592
  • Votes 136
  • Parts 14
  • Time 2h 13m
cyborgladiator
Ongoing, First published Nov 18, 2014
deathdimiensionsevilfantasyfirefreechristianliticemagicmetasprojectrefreshpsychopathwattys2016wizards
In a world plagued by evil, and darkness. Light will rise to challenge the darkness, good will challenge evil. A prince will challenge a king.
  
  Watching as his mother died - the evil king's son, Ryden, only has on goal in mind: to end his father's tyranny. Joined with his friends he will take on a deadly quest for a mystical sword that may grant him the key to unlocking his goal. Along his journey, he makes unlikely allies and dangerous enemies.
    
  [Updated Sporadically]
All Rights Reserved
deathdimiensionsevilfantasyfirefreechristianliticemagicmetasprojectrefreshpsychopathwattys2016wizards
Table of contents

14 parts

Sign up to add Trinity to your library and receive updates
or
#35projectrefresh
Content Guidelines
You may also like
Wizardly by lilshadowwolf
45 parts Complete Mature
A normal orphaned boy living in a world of magic. How will his story unfold?
THE STONE KING -- book two of The Chronicles of the First Age by JAPartridge
50 parts Complete
Twenty years ago, Garanth's father killed Garanth's mother and cursed the land by opening a passage for the spirits of the Void. Now the spirits of the Void are consuming the spirits of the land in a spreading curse of death. At the same time, Garanth's half-brother, possessed by those same spirits, is leading an expanding army driven mad by fear and hunger, absorbing village after village in a quest for absolute power. To save the land, Garanth must defy his mentor and claim the Seat of Power before his brother reaches it, knowing it will cost him his humanity.
Honour or Reason - Book 1# in the Burning Prince Chronicles by elsiecorlis
42 parts Complete Mature
WINNER OF THE CHOSEN DARKLING 2023 #1 in Fae Romance FEAR IS THE PATH TO DESTRUCTION. After the King of Maidora dies, chaos ensues. When Prince Conlaed is visited by vision, he discovers that his father's 'peaceful' death may not have been so peaceful after all. PAIN IS THE PATH TO INJUSTICE. Desperate to uncover the truth, he sets himself on a path of retribution. But the truth is easily tangled within lies, and Conlaed begins to realize that the death of his father may have only been the beginning. REVENGE IS THE PATH TO DEATH. Deeper plots lie in wait, and if he does not stop them, they may just destroy everything he loves.
Discovering the Ligon by JadeRyan059
29 parts Complete Mature
Warning: This story is for mature audiences only. It contains language and scenes that would get this story rated R if it was a movie. It is also RH - reverse harem. Blurb: When you make friends as children, you imagine you'll stay friends forever. It's a childlike hope and guilelessness about the real world. I had that with Ryker, Ryan, and Zeke. But everything changed when we turned 15. Ryan left first. Distanced himself from our group. Then Ryker and Zeke. Ryker abandoned me to the gossip from the incident while Zeke watched me verbally, and sometimes physically, be harassed. No one cared. Not them. Not the adults, the protectors in the Pride. I was an outcast because of my birth. The abomination that shouldn't exist. Finally, my 18th birthday was coming up. I could leave. Be free from the ridicule and dirty looks. Snide comments. Until Ryker returned with a secret about me and all hell broke loose. The question is... Will the guys stay this time or leave me to face this secret alone?
The Dragon And The Fae by taryntary
10 parts Ongoing Mature
Ryke is the dangerous and fierce king of dragons who is seeking revenge against the faeries for killing their clan member. So when a faerie stumbles into his territory seeking revenge against the same enemy, she is taken as his prisoner where deals are made and sealed with magic. But little did they know that hate is a thin line and clawing each other's eyes could blind them into love. But will they surrender to the stinging fate they have been destined upon? Or will they reweave the threads of their fate? (Contains violence and mature contents) ©All rights reserved, including the right to reproduce this book or portions thereof in any form whatsoever. (The cover of the book belongs to the original source.)
The Voice Within by Robertonewyork
4 parts Ongoing
In a world where races like elves, dwarves, and humans are constantly at odds, Ryker, a teenage boy, is caught in the middle of a dangerous pursuit. Born half-elf, half-human, Ryker's very existence is illegal, forcing him to live in hiding with his guardian, Doc, a mysterious and skilled doctor who raised him with discipline and care. On the night of Ryker's birth, a violent storm raged, and a strange face appeared in the fire, marking his life with an air of mystery and danger. Now, on his 17th birthday, Ryker's secret is discovered, and multiple races-including gods-begin hunting him for reasons he does not yet understand. Doc, always prepared for emergencies, has trained Ryker in survival tactics, teaching him to use hidden meeting points and escape routes. But for the first time, Ryker must put these plans into action on his own. As he tries to evade capture, Ryker reflects on the strained yet loving bond he shares with Doc, recalling moments of harsh lessons and tough love. Despite Doc's strictness, Ryker knows he is more than capable of handling the dangerous world around him. He must now navigate a forest filled with guards, untrustworthy villagers, and his own fears, all while unraveling the mystery of his heritage and why so many are after him. Armed with his intelligence, survival skills, and a powerful weapon said to be able to destroy gods, Ryker embarks on a journey that will challenge everything he knows about himself and the world. As he faces powerful enemies, including gods, and confronts the mystery of his father, Ryker discovers that his mixed blood may be the key to saving-or destroying-the world.
Lost souls by Ladydarkwriter
42 parts Ongoing Mature
Raor, a knight adopted by the Unseelie Fairy folk, has a curse to break. If he does not kill the Demon Eshmodath, he will die. After reuniting with his guild companions, his plans are disrupted by a young woman with pointed ears who imprisons them in an enchanted mansion. She reveals little about herself, except that she is a "Yiddishet," and exerts a strong magnetism over Raor. Determined as always, he must find a way to escape his captivity, facing the dark intentions she has against him. ☾ Story genre: romance, epic fantasy ☾ ⊰───⋅⋅───⊱⊰───⋅⋅───⊱⊰───⋅⋅───⊱⊰─ ↓ ✦ Trigger warning: SPICY SCENES, MATURE CONTENTS. ✦ Cover created with AI. ✦ Copyright ©2024 by LadyDark.
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
✔︎ | Gold Digger by writingtaurus
28 parts Complete Mature
WARNING: CRINGE-WORTHY Jessie, a seventeen year old girl with an abusive past and a gold - digging mother, has no idea what life in the real world is like. Forced to move from her home when her mother gets remarried, she begins realizing what she really cares about, and unlike her mom, it's not money. It's love. Something she has never had. Ryker, a boy with a horrifying past of drugs and crime, has no idea what he wants. But after everything he has been through, the bad boy becomes the most terrifying part of any high schooler's day when they are forced to be around him after he leaves juvy and comes back to high school. When Jessie attacks Ryker at school as he's bullying a little boy, everything changes for the both of them, for better, but most likely, for worse. "I'm Ryker, Ryker Knight." "Is your name supposed to mean something to me?" "You'll realize, Princess, that it will someday, one way or another."
Monstrum by ScarlettOlivier
7 parts Ongoing Mature
📢📢Cascade schedule for chapter release. New chapters are released every Wednesday every week, except for the fourth week. No chapters will be published on the fourth week.✨️ In a forgotten dukedom, where shadows cling to ancient walls and whispers of a curse echo through desolate halls, Chante finds herself trapped between a fading legacy and a world teetering on the edge of ruin. With her father's mind slipping and war ravaging the country, danger looms closer than ever. Beasts stalk the land, and the curse that binds them threatens to consume everything she holds dear. Determined to protect her ailing father, Chante is drawn into a web of intrigue and peril-one that could unravel both her family and the world itself. As she ventures deeper into the heart of the mystery, she faces an impossible choice: break the curse or watch everything fall to dust. But time is running out, and with each passing day, the weight of destiny grows heavier. The last petal is falling. Synecdoche: Book 1 First draft, revisions ahead! Genre: Paranormal, Fantasy, Romance, Gothic Horror Content Warning: Blood, violence, mature themes. Trigger Warnings: Mental illness (dementia), parental loss/grief, abuse (emotional and physical), animal cruelty, violence, gore, death/dying, manipulation, gaslighting, horror elements/monsters. 🔞
You may also like
Slide 1 of 10
Wizardly cover
THE STONE KING -- book two of The Chronicles of the First Age cover
Honour or Reason - Book 1# in the Burning Prince Chronicles cover
Discovering the Ligon cover
The Dragon And The Fae cover
The Voice Within cover
Lost souls cover
The Bane of the Empire cover
✔︎ | Gold Digger cover
Monstrum cover

Wizardly

45 parts Complete Mature

A normal orphaned boy living in a world of magic. How will his story unfold?

More details