Closing the Distance Between Us
8ullred
  • Reads 1,555
  • Votes 47
  • Parts 5
  • Time 1h 11m
  • Reads 1,555
  • Votes 47
  • Parts 5
  • Time 1h 11m
8ullred
Ongoing, First published Jun 15, 2021
abyssaeqingaetheraetherxkeqinggenshinimpactkeqingmysteryromance
An incident at the Guizhong Ballista draws the Qixing's attention. However, the figure at the center of this trouble appears to have an overarching plan. It will be up to the Yuheng to penetrate his defenses and to find out the real plan, if there is any at all. 

Takes place before the Liyue Archon quest, ends at the Lantern Rite. Lumine is the Traveller. Abyss!Aether x Keqing
All Rights Reserved
abyssaeqingaetheraetherxkeqinggenshinimpactkeqingmysteryromance
Table of contents

5 parts

Sign up to add Closing the Distance Between Us to your library and receive updates
or
#165abyss
Content Guidelines
You may also like
Sweet Dreams || Xiaolumi by avery_conwell
9 parts Ongoing
- x x - "I've never liked dreaming. No matter what I dreamed of, I could neither control it nor easily escape. But, recently.. it's you that I keep seeing." "..Me? Of all people? Why not Zhongli, or Ganyu?", Lumine asked. She seemed pleasantly surprised, but her tone had a hint of curiosity in it. "I don't know. All my dreams of you are of idle strolls and outings. Every time I awake, I can't help but wonder if I deserve to have such sweet dreams. Even now, I can't find the answer to that question.", Xiao replied. "Well, I'm glad your dreams now are pleasant, at least." Lumine smiled. Her golden eyes shined like topaz under the night sky. "Do you really enjoy spending time with me that much?" "Honestly, I do.", Xiao turned to face her. "Spending time with you is the highlight of my day." Xiao smiled, but it faded just as quickly as it appeared. Lumine looked at him and smiled. Then, she offered him her hand. Xiao looked at her hand, and, although he was a bit hesitant at first, he held her hand. Then, they looked back at the stars. - x x - A story about Xiao and Lumine falling in love, as well as a few peeks into Xiao's past. Just as simple as that. !! DISCLAIMER !! I do not own any of the characters in this story. All of these characters come from the game Genshin Impact, which belongs to Mihoyo/Hoyoverse. - x x - Placeholder cover art by: BrillP You can find the artwork here: https://wall.alphacoders.com/big.php?i=1131454 Official cover art by: Zibbo - x x - I hope you enjoy this story!
You Can Do It Chongyun! [School AU] by TheFlyingJaybird
15 parts Complete
[COMPLETED ◌ March 16 2021] (Warning, in this story both travelers have ships of both AmberxLumine, and DilucxAether. If you have a problem with such a minor part in the story please leave or ignore it. If you comment on it your comment will get deleted. Now, enjoy) Chongyun has a crush, and everyone except the one he has a crush on. His friends try to encourage Chongyun to ask Xingqiu out, but will he actually mange to do it? Valentine's Day will put this all to the test!
One flower, One sword by Alisionisy
7 parts Complete
One day Paimon and Aether encounter a strange monster that looks similar to a lector in the middle of Guili Plains. "Xiao! Thanks Archons your here! Aether was fighting this super scary looking monster and..." "What happended to the Traveller? Nevermind, there's no time for talk. Take him up your room..." -------------------------- not really consistent updates. Cover Art and characters do not belong to me. Little Spoiler: A Hillichurl ends up being used as a sacrifice in the middle of some ritual ;) monthly chapters
Show me by Tashimo-Rinfu
18 parts Complete Mature
Xiao x aether WARNING: SMUT ( ͡° ͜ʖ ͡°) ____ Feelings were something Xiao was pushing away. Scared they would overcome his life, he was ignoring them to make himself stronger cause he had a duty: to protect liyue. Some traveller may change his mind. But love come with new duties. And problems...
We will find our return✧Genshin X MHA✧ by Alkemti
15 parts Ongoing
"Traveler I'm afraid we'll have to leave your companion out of the domain, as I can sense a lot of Abyssal energy circulating through the domain, and I only have enough strength to decrease the influence of it on only two people" ---------------------------------------------------------------------------------✧✧ "AETHER DON'T TOUCH IT!" "Lu-mine?" --------------------------------------------✧✧ "Can't you just send us back to Teyvat" "No, I can't I've spent too long in the Abyss, so I am unable to use that power of ours anymore, and since you used yours by accident, we now have to wait for it to recharge" "Recharge?" -------------------------------------------------------✧✧ While Aether was exploring a peculiar domain, he and Dainsleif came across a strange stone, that unlocks Aether's original powers however it also causes both him and his sister to be transported to another world, with the situation of being unable to return to Teyvat. How will the Twins live in this world of heroes and villains, while they wait for Aethers transportation power to fully return to him. ✧✧✧✧ none of the characters in this story belong to me. Aether and Lumine are from genshin impact. every other character used is from MHA
The pursue of the past by TierS_Assassin
12 parts Ongoing Mature
The story focuses on a young woman named Keqing, who was borned and raised in Liyue, she once finds a man that was wandering all covered in wounds and in his own blood around the Yuehai Pavilion, where the Yuheng of the Liyue Qixing works. Keqing attends the wounds of the young man who seems to have amnesia and he is unable to remember anything but his name. This story will focus on who this man is. Also, this fan-fiction brings into the world of Teyvat a power from an anime well known among the anime-fans. I won't tell you what anime it is since it would spoil the fun, so, please enjoy.
DRAGON BALL IMPACT: AB by Literally_A_Batman
16 parts Ongoing
Aether, the enigmatic traveler who arrived in Teyvat, was on a quest to find his sister. But what if his journey held a far greater purpose? What if it was destined to awaken the forgotten memories of his past-a past that could crown him as the new God of Destruction. Dragon Ball x Genshin Impact. Achievements: No.7 on #Lumine Out of 4k+ stories (01/06/25)
My Greatest Treasure (XiaoLumi) by SmolSoap
10 parts Ongoing Mature
(Events take place before the inazuma arc) A Traveler from out of this world, will soon depart from Liyue and continue her journey to find her brother. Inazuma is her next stop, but an adeptus she treasures dearly, can't seem to let her go. The adeptus can't leave Liyue, while Lumine can't stay. How will their relationship work in such circumstances?
Abyss Aether × Xiao || You can try to escape || by OopOop073
33 parts Complete
One day Aether is in the nation Liyue, unable to summon an Abyss Mage due to his low stamina and lack of power at the moment. While in Liyue he unexpectedly runs into his lost twin Lumine, but he does not wish to speak to her and when he wants to leave he is met with something else.... Xiao Some smut and some fluff, but mostly them being idiots and fighting
You may also like
Slide 1 of 9
Sweet Dreams || Xiaolumi cover
You Can Do It Chongyun! [School AU] cover
One flower, One sword cover
Show me cover
We will find our return✧Genshin X MHA✧ cover
The pursue of the past cover
DRAGON BALL IMPACT: AB cover
My Greatest Treasure (XiaoLumi) cover
Abyss Aether × Xiao || You can try to escape || cover

Sweet Dreams || Xiaolumi

9 parts Ongoing

- x x - "I've never liked dreaming. No matter what I dreamed of, I could neither control it nor easily escape. But, recently.. it's you that I keep seeing." "..Me? Of all people? Why not Zhongli, or Ganyu?", Lumine asked. She seemed pleasantly surprised, but her tone had a hint of curiosity in it. "I don't know. All my dreams of you are of idle strolls and outings. Every time I awake, I can't help but wonder if I deserve to have such sweet dreams. Even now, I can't find the answer to that question.", Xiao replied. "Well, I'm glad your dreams now are pleasant, at least." Lumine smiled. Her golden eyes shined like topaz under the night sky. "Do you really enjoy spending time with me that much?" "Honestly, I do.", Xiao turned to face her. "Spending time with you is the highlight of my day." Xiao smiled, but it faded just as quickly as it appeared. Lumine looked at him and smiled. Then, she offered him her hand. Xiao looked at her hand, and, although he was a bit hesitant at first, he held her hand. Then, they looked back at the stars. - x x - A story about Xiao and Lumine falling in love, as well as a few peeks into Xiao's past. Just as simple as that. !! DISCLAIMER !! I do not own any of the characters in this story. All of these characters come from the game Genshin Impact, which belongs to Mihoyo/Hoyoverse. - x x - Placeholder cover art by: BrillP You can find the artwork here: https://wall.alphacoders.com/big.php?i=1131454 Official cover art by: Zibbo - x x - I hope you enjoy this story!

More details