Kpop Groups I Stan
somegirlgroupstan
  • Reads 592
  • Votes 1
  • Parts 19
  • Time 7m
  • Reads 592
  • Votes 1
  • Parts 19
  • Time 7m
somegirlgroupstan
Ongoing, First published Jun 23, 2021
aespablackpinkeverglowgfriendgidleitzyiveizonekissoflifekpopkpopgirlgroupskpopguidelesserafimmamamoopurplekissredvelvetsnsdstayctwice
Hi! This is just a compilation of the Kpop Groups I Stan (mostly girl groups) and some info about them :3
I'm doing this just for fun but I hope it becomes a guide to someone so they can Stan this wonderful groups :D
Public Domain
aespablackpinkeverglowgfriendgidleitzyiveizonekissoflifekpopkpopgirlgroupskpopguidelesserafimmamamoopurplekissredvelvetsnsdstayctwice
Table of contents

19 parts

Sign up to add Kpop Groups I Stan to your library and receive updates
or
#895mamamoo
Content Guidelines
You may also like
Leah's Writer's Room by flowersforleah
12 parts Ongoing
Want to ask me questions? See my behind the scenes? Even see my upcoming story sneak peeks? Here you can request for a chapter read request as well as critique. There's even something better-talking to me about anything you want!
You may also like
Slide 1 of 1
Leah's Writer's Room cover

Leah's Writer's Room

12 parts Ongoing

Want to ask me questions? See my behind the scenes? Even see my upcoming story sneak peeks? Here you can request for a chapter read request as well as critique. There's even something better-talking to me about anything you want!

More details