The Legend of: Annora Petrova
therealhyujin
  • Reads 43
  • Votes 0
  • Parts 2
  • Time 5m
  • Reads 43
  • Votes 0
  • Parts 2
  • Time 5m
therealhyujin
Ongoing, First published Jul 02, 2021
annorapetrovabrutalcreepypastacrimedarkdeathfictiongooglegorehauntedhorrorhorror-thrillerhyujinlegendsmurdermysterynewbooknewstorypsychologicalscaryspookythrillerurbanurbanlegends
- There is a creepy story attached to this name that has been circulating for years on the internet. Many people believe the story while others don't. Nevertheless, don't ever search your name on google.

https://creepypasta.fandom.com/wiki/Annora_Petrova
Public Domain
annorapetrovabrutalcreepypastacrimedarkdeathfictiongooglegorehauntedhorrorhorror-thrillerhyujinlegendsmurdermysterynewbooknewstorypsychologicalscaryspookythrillerurbanurbanlegends
Table of contents

2 parts

Sign up to add The Legend of: Annora Petrova to your library and receive updates
or
#431urbanlegends
Content Guidelines
You may also like
Indian short stories by Narrativenest
66 parts Ongoing
Collection of different Indian short stories.
LOVE by SweetMilkPudding05
21 parts Ongoing
'LOVE' ဆိုတဲ့ ရိုးရိုးရှင်းရှင်း စကားလုံး​လေးကို ပန်း​လေးနဲ့​ဖော်ပြရရင် နှင်းဆီနီ​လေးတစ်ပွင့်ပါပဲတဲ့။ ဒါ​ပေမဲ့ ကျွန်​တော့်သက်ဆိုင်သူက​တော့ စံပယ်ပန်း​​လေးတွေကိုသာ နှစ်သက်တတ်ပါသတဲ့​လေ။ ဒီလိုဆို​တော့လဲ ကျွန်​တော့်အတွက် 'LOVE' ဆိုတာကို အစ်ကိုကြိုက်တဲ့ စံပယ်ပန်း​လေး​တွေနဲ့ပဲ သတ်မှတ်လိုက်တာ​ပေါ့။ (Punishment Type ပါ၀င်​နေတာ​ကြောင့် အဆင်​ပြေမှသာ ၀င်ဖတ်ပါရန်)
OUR ARRANGED LOVE MARRIAGE by _thebutterfly__
68 parts Complete
An Arranged Marriage with a spark of love!! Two people tied in a pious bond of marriage by their family. Sounds boring?? Arrange Marriage?? Ohh, it is Arranged but..... with love! Dive in to see the not so simple life of Ahmeds and Shahids.... This is my first story ever so there'll be mistakes but I tried my best!? Thank you for giving my story a chance!!
HOME (Complete) by SweetMilkPudding05
35 parts Complete
ပုံသဏ္ဍာန်ချင်း မတူညီတဲ့ ချစ်ခြင်း​မေတ္တာ​​​လေးတွေကို စု​ပေါင်းထားပြီး ခိုလှုံလိုက်တာနဲ့ ​နွေး​ထွေးလုံခြုံသွား​စေမယ့် အိမ်​လေးတစ်လုံး။ (Punishment Type ပါ၀င်​နေတာ​ကြောင့် အဆင်​ပြေမှသာ ၀င်ဖတ်ပါရန်)
No Going Back by AgaciaR
19 parts Ongoing
𝘙𝘢𝘯𝘥𝘰𝘮 𝘙𝘦𝘢𝘭𝘪𝘵𝘪𝘦𝘴 Book 3 Unforgivable Series #2 Where should your husband be when you're having a difficult, risky pregnancy? Right by your side! Where was he though? With his childhood best friend and business partner, partying, kissing and making out or worse. All marriages have ups and downs, but once you take a one-way route of cheating, there is No Going Back.
𝐒𝐢𝐧𝐠𝐥𝐞 𝐝𝐚𝐝 ~ 𝐎𝐧𝐞𝐬𝐡𝐨𝐭𝐬 by 00_mafia_00
27 parts Ongoing
The One-shots revolve around the journey of a devoted single father navigating the complexities of parenthood and his deepening bond with his sons. Each story highlights the unique challenges and heartwarming moments they share, capturing the essence of love, resilience, and the unbreakable ties of family. If you are interested, please check it out. I hope you enjoy it.
🍰Fruit Cake 🍰 by Desir3_lov3s_fir3
41 parts Ongoing
Sxs Oneshots 🤪
ညီအစ်ကိုငါးယောက်ရဲ့ဒွိလိင်လေး(Complete On Pdf File) by kiwis305
9 parts Ongoing
18+စာဖြစ်သဖြင့် ချင့်ချိန်ဖတ်ပါရန်🥝🥝
Oneshots by funvfbbgh
18 parts Ongoing
Smutt Fluff Maybe angst this will contain lesbian, gay and straight (if it's straight, the male will not be dominant it's all femdom.) BDSM
A-ဧ by BreezeNway
40 parts Ongoing
အထက်တန်းမှာ ကြိုက်ခဲ့တဲ့အချစ်ဦးလေးနဲ့ 3နှစ်ကြာပြီးနောက် ပြန်တွေ့သောအခါ...
You may also like
Slide 1 of 10
Indian short stories cover
LOVE cover
OUR ARRANGED LOVE MARRIAGE cover
HOME (Complete) cover
No Going Back cover
𝐒𝐢𝐧𝐠𝐥𝐞 𝐝𝐚𝐝 ~ 𝐎𝐧𝐞𝐬𝐡𝐨𝐭𝐬 cover
🍰Fruit Cake 🍰 cover
ညီအစ်ကိုငါးယောက်ရဲ့ဒွိလိင်လေး(Complete On Pdf File) cover
Oneshots cover
A-ဧ cover

Indian short stories

66 parts Ongoing

Collection of different Indian short stories.

More details