The Legend of: Annora Petrova
therealhyujin
  • Reads 41
  • Votes 0
  • Parts 2
  • Time 5m
  • Reads 41
  • Votes 0
  • Parts 2
  • Time 5m
therealhyujin
Ongoing, First published Jul 02, 2021
annorapetrovabrutalcreepypastacrimedarkdeathfictiongooglegorehauntedhorrorhorror-thrillerhyujinlegendsmurdermysterynewbooknewstorypsychologicalscaryspookythrillerurbanurbanlegends
- There is a creepy story attached to this name that has been circulating for years on the internet. Many people believe the story while others don't. Nevertheless, don't ever search your name on google.

https://creepypasta.fandom.com/wiki/Annora_Petrova
Public Domain
annorapetrovabrutalcreepypastacrimedarkdeathfictiongooglegorehauntedhorrorhorror-thrillerhyujinlegendsmurdermysterynewbooknewstorypsychologicalscaryspookythrillerurbanurbanlegends
Table of contents

2 parts

Sign up to add The Legend of: Annora Petrova to your library and receive updates
or
#851google
Content Guidelines
You may also like
No Going Back by AgaciaR
12 parts Ongoing
𝘙𝘢𝘯𝘥𝘰𝘮 𝘙𝘦𝘢𝘭𝘪𝘵𝘪𝘦𝘴 Book 3 Unforgivable Series #2 Where should your husband be when you're having a difficult, risky pregnancy? Right by your side! Where was he though? With his childhood best friend and business partner, partying, kissing and making out or worse. All marriages have ups and downs, but once you take a one-way route of cheating, there is No Going Back.
jk smut Twoshots by jeeeeemnn
8 parts Ongoing
yn : ah baby mommy will to you a child after nine months
Indian short stories by Narrativenest
46 parts Ongoing
Collection of different Indian short stories.
မောင့်ထိဂရုံး!Horror! by ThuRa9220
22 parts Complete
"သွေး ဆိုတာ သူတို့နဲ့ ထိုက်တန်လို့ ကျသာပါမောင်" "ေသြး ဆိုတာ သူတို႔နဲ႕ ထိုက္တန္လို႔ က်သာပါေမာင္"
Alessia Russo Oneshot by woso_wosolover
165 parts Ongoing
Oneshots on Alessia Russo If you have an ideas on what you want the oneshots to be on then comment at the end of each of them .
🔞ហឹរ 2+3នាទី🥵🔥 by AgustRed0693
19 parts Ongoing
🗣️: បើមិនចូលចិត្ត ពាក្យពេចន៍មិនសមរម្យឬចំៗ សូមកុំចូលអាន [BL]🔥🔞🥵 Tae X +++ (S+E+X) [17.10.24]
WOSO Oneshot by woso_wosolover
154 parts Ongoing
A WOSO Oneshot book Oneshots of favourite Women's footballers Mainly the Lionesses, Arsenal Women's team,Chelsea Women's team, Man City Women's team and Man Utd Women's team
Short Novel by Janely_kim
39 parts Complete
រឿងមួយនេះជាប្រភេទ BL s*x ចង់អានក៏អានចុះតែបើប៉ះពាល់អារម្មណ៍កុំបន្ទោសអ្នកសរសេរឲ្យសោះហើយក្នុងនេះក៏មានពាក្យមិនសរម្យច្រើនដែល🤏🔞 Taekook all story 🤯 ____________________________ Writer by me junalifa <3
𝐓𝐡𝐞 𝐔𝐧𝐛𝐫𝐞𝐚𝐤𝐚𝐛𝐥𝐞 𝐁𝐨𝐧𝐝 by 00_mafia_00
38 parts Ongoing
A story of four brothers whose life revolves around each other. Fate wasn't kind to them, but they were in it together, always have been and always will be. The eldest brother who is known to be a cold, arrogant and emotionless CEO can destroy the world for his younger brothers. Dare look at his brothers with any ill intention and he won't think twice before destroying the lives of those individuals. He has been a father figure to his brothers since the death of their parents in a car crash. When it comes to them he is a total softy and looks after their every need, but this doesn't mean that he won't discipline them if they are in the wrong. Will these brothers be able to maintain the unbreakable bond they have? When some secrets are revealed of the younger brother, will the trust remain the same between them? What has fate planned for them? Peep into the story of these brothers to know further about their lives...... 🫣
The Life of Amelia Potter (WTM) by JenniferCampbell9
40 parts Ongoing
When the final battle of hogwarts is over, too many people were lost. So the Emerald Trio (aka golden trio) and their friends decided to travel to the past to change the course of the future. Hogwarts Legacy Crossover (Does NOT follow movies. New stroyline. Some dates may differ.) *I do NOT own Harry Potter or J.K Rowling's characters*
You may also like
Slide 1 of 10
No Going Back cover
jk smut Twoshots cover
Indian short stories cover
မောင့်ထိဂရုံး!Horror! cover
Alessia Russo Oneshot cover
🔞ហឹរ 2+3នាទី🥵🔥 cover
WOSO Oneshot cover
Short Novel cover
𝐓𝐡𝐞 𝐔𝐧𝐛𝐫𝐞𝐚𝐤𝐚𝐛𝐥𝐞 𝐁𝐨𝐧𝐝 cover
The Life of Amelia Potter (WTM) cover

No Going Back

12 parts Ongoing

𝘙𝘢𝘯𝘥𝘰𝘮 𝘙𝘦𝘢𝘭𝘪𝘵𝘪𝘦𝘴 Book 3 Unforgivable Series #2 Where should your husband be when you're having a difficult, risky pregnancy? Right by your side! Where was he though? With his childhood best friend and business partner, partying, kissing and making out or worse. All marriages have ups and downs, but once you take a one-way route of cheating, there is No Going Back.

More details