Story cover for Cinderella - A Retelling with Strength and Courage by lisasheaauthor
Cinderella - A Retelling with Strength and Courage
lisasheaauthor
  • WpView
    Reads 1,114
  • WpVote
    Votes 54
  • WpPart
    Parts 11
  • WpHistory
    Time 1h 0m
  • WpView
    Reads 1,114
  • WpVote
    Votes 54
  • WpPart
    Parts 11
  • WpHistory
    Time 1h 0m
lisasheaauthor
Complete, First published Jul 04, 2021
archercastlecinderellacomingofagefairytalefantasykidnappingleavinghomemedievalprince
69 pages 

Cinderella made a vow to her mother, before her mother tragically passed away on midwinter's day. Ella swore to watch over her father and care for him. But then her father married anew. Her stepmother and two stepsisters took sharp delight in causing Ella grief from morn to eve. They bullied her, called her Cinderella, and treated her as little more than a slave in her own home. It took all of Ella's courage to swallow the insults and to honor her word.

Now the crown prince has returned home from the battlefront; a ball is announced to celebrate his arrival. All eligible young women from the entire kingdom are invited to attend.

Ella has but one desire left. She wishes to see the king's gardens one last time before she leaves home. It will be a final way to commemorate her beloved mother before counting her vow's terms as complete.

She has no idea what awaits her on that arched stone bridge ...

* * *

Cinderella - A Retelling with Strength and Courage is Book 1 of a gently cliff-hangered short story series. The series honors the original intention of the Grimm Fairy Tales - to present women of strength and courage tackling challenges which seem insurmountable. With each new book a new heroine is interwoven into the story. The series sequence leads through five books up to a happily ever after ending. The series is clean romance and is suitable for teens and up.
All Rights Reserved
archercastlecinderellacomingofagefairytalefantasykidnappingleavinghomemedievalprince
Table of contents

11 parts

Sign up to add Cinderella - A Retelling with Strength and Courage to your library and receive updates
or
#48leavinghome
Content Guidelines
You may also like
Glass Slippers [1st Draft] by Pennywithaney
40 parts Complete
Clara's problems can be summed up in two words: responsibility and family. After the loss of her mother, life for Clara was never the same. Although she loves her three siblings and tries to be the best sister and lady she can, the weight on her shoulders grows the more she learns and the more she has to know. When her father remarries to a secretive widow, Clara's responsibilities triple overnight. Through no fault of her own, Clara is thrown into an adventure she never counted on-- one of magic, tragedy, and romance. Through palace ballrooms, enchanted forests, and encounters with a handsome stranger she really shouldn't care for, Clara soon realizes that the only way to help her family and fix the problem is to do it herself. The only trouble is that she doesn't know how. A Cinderella Retelling. ----- Cover design made by solidarity_! First draft! *featured by Once Upon A Time as of 9/24/2015*
Of Blood and Duty by WhiteGoldFangs
29 parts Complete Mature
Wattpad Exclusive! Nearly beaten to death, a man wakes up in a place he does not know. Neither can he remember how he even ended up there. Waking up in the middle of a road he discovers a world of pain only to drift off into unconsciousness again. His body having been crushed and broken beyond his wildest dreams. Falling out of consciousness from the pain, he later wakes up in a bed. A new place he does not know, but being looked after by someone. A woman. Why was he in the care of this beautiful but strange person? How had he ended up in her care? Why had she taken him in and why was she and everyone else so guarded around him? Determined to make his way back home, wherever that may be, the man soon realizes that things are not as easy as he first had thought. Learning to fit in with the people who took him in at the brink of death, he learns that a war is raging between two kingdoms, and which one he belongs to, he cannot remember... if he belongs with to any of them. All he has to remind him of his life before is a sword with a crest of two lions on its pommel... and a woman named Jade who screams for him in his sleep. This is a spin off of The Prince's Choice and Hunted Queen. I recommend reading those two before this one to get the best experience possible!
La Petite Pantoufle De Verre 🦋 by RewrittenWorks
42 parts Complete
~After a young girl loses both her parents and is left stranded with her cruel stepmother and mean stepsisters, she finds herself in a horrible environment. Until one day, the prince decided to host a grand ball where every maiden in the land was invited to attend. The both of them meet each other at the royal ball and share the first dance. But before the prince was able to get the name of the maiden, she had to leave as she had to be home before midnight. And in doing so she left behind a glass slipper. The prince then uses this to aid him in his search for the mysterious girl...but will he find her? Disclaimer: Story is in English! A French version is in the works! ~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~•~ ~(Please note that this is a Disney novelisation of the 2015 live-action remake of Cinderella, with some incorporations made from details derived from the original Cinderella film created by Disney in 1950 along with many of my additions. Essentially in the way that books are produced into films, this is just the opposite where a film is now turned into a story.) All applicable rights are reserved to Disney and to whomever necessary from within their enterprise and more. ~{Grammar check and proofreading is now complete; 1st Feb 2024}, I greatly apologize in advance for any errors that I might have missed. If I might have missed anything at all don't hesitate to make me aware of it by any means...thank you ~ Second grammar check currently in progress as of January 2025! ~I hope you enjoy the story as much as I did writing and planning it 💙
Once Upon A [Stolen] Time - [Stolen] Series I by SamreenAhsan
20 parts Complete Mature
**Added on the reading list of @retold @WattpadTimeTravel @WattpadFairytales @HistoricalFiction @WattWitches @Magic @WattpadBookshelves This is book 1 of [STOLEN] SERIES 2015... All her life, Myra Farrow has been obsessed with medieval castles-and the kings and princes who once inhabited them. Now, wealthy videogame designer Steve Bernard wants her to model for a princess character in his new game. Myra can't resist his offer, especially when she learns that Steve plans to film inside the mysterious Hue Castle-a cursed, barren, colorless place forbidden to visitors for centuries. But unknown to Myra, her soul is bound to Hue Castle by blood and sorcery. When she enters its doors, she awakens dark powers that will reach through time-stealing her past, torturing her present, and rewriting her future. 1415... Edward Hue, the last of the Hue royal bloodline, has never stood in the sunshine or held a living flower. Cursed from birth to live in darkness and bring death to all he touches, he is at the mercy of his cruel, tyrannical father, who will not rest until he shatters Edward's soul and makes his son into a diabolical copy of himself. Edward's one hope is the mysterious woman who haunts his dreams-who will either break his curse and bring him out of the darkness, or destroy him utterly. In this modern day retelling of Beauty and the Beast, past and future collide in a tale of love, obsession, betrayal, and the hope for redemption. Once Upon A [Stolen] Time © 2024 by Samreen Ahsan
Heartless by Layanabella
34 parts Complete Mature
My body trembled, but not from the cold. "You frighten me." His brow twitched, eyes darting around the features of my face. "Frighten, or excite?" His gaze dropped to my mouth. "Which is it, Miss Young?" ❆ Once upon a time in a dying village, there lived a girl who dreamed of a life free of fear and death. She yearned for a world not ruled by the darkness and the demons awaiting her inside it... For nearly eighteen years, Adaira Young has been able to hide from the monsters that plague her small village. Every year in Kinnot, a name must be drawn to be offered to the beasts from the mountains. Once they are sacrificed and disappear through the gates, they are never seen again. When Adaira's world comes crashing down around her and she finds herself on the outside of those very walls, Adaira comes face to face with the monster she's been cowering from all her life: A terrifying man named Beast. Whisked away to his palace in the icy mountains, Adaira struggles to adjust to her new life and fight the dangerous feelings of attraction growing inside her. But as the days grow colder and their relationship grows stronger, a deadly secret from Beast's past threatens to shatter everything. To live, he needs the one thing Adaira has to die for in order to love her: her heart. **A Beauty and the Beast retelling🖤♥️ Updates randomly, but mainly Friday's ⚠️❗️This book includes material that may be graphic to some viewers. Please take caution when reading⚠️❗️
Escaping the Castle by Whitney_Joseph
41 parts Complete
Forced to live in a castle with her wicked father, Ariel wants to escape her life of torture. At only eleven years old, Ariel feels a void in her life as she has no mother and lives in an isolated area with her father, hidden from the world. Ariel longs to know who her mother was and find out the truth behind her mother's death. When Ariel finally fears that she may be killed by her father, her aunt makes plans with her uncle to escape the castle. Ariel escapes the castle and finally has a normal childhood. But what happens years later when Raymond decides to torment Ariel's life again and punishes his brother for taking his daughter away from him, ruining Henry's life for taking Ariel away. Will Ariel be able to fight back? And what if her mother is still alive? Will she be able to unravel the mystery behind her mother's kidnapping by Raymond all these years ago? And what happens when she meets her mother's family who didn't know she existed? Will they accept her or chase her away? Although Ariel escaped the castle, is she bound to be living in the castle forever? Read to find out as the truth is revealed. ____Do not copy my story. It is an original_______ Books in the Castle Series: 1.Kidnapped to Live in a Castle 2. Escaping the Castle 3.Living in a Castle
Descendants of the Kings (Book 2) by paperweightfairy
153 parts Ongoing Mature
Once upon a time, a wise Queen predicted that after millennia of peace, the evils she had once fought to vanquish would come back to seek vengeance. Men and Fae, under the thumb of one common enemy. When all hope seemed lost, in the darkest hour, the heroes once prophesied would rise again. The descendants of the Kings-- young warriors willing to defy it all to save them. Ella is not the young woman that left Rhothomir all those months ago. She has a choice to make now. She has a role to play, more significant than anything she could have imagined. Will it be more than she bargained for? Magic, life and death all have a price, and Ella will find out just how steep that price is. In a story written long before she was born, death might be the only answer, but it certainly isn't the end. The second and final book in the HOG duology, a fantasy story full of action, romance and magic!
The Runaway Prince by Wildfirewish
30 parts Complete
I couldn't help but smirk "Whatever the crown prince wants right?" I had said ~~~~~~~~~~~~~ I got him down quickly, my blade to his throat so he wouldn't try anything. ______________________________________________________________ Kendra is the only princess her mother has, her mother had high hopes for her. But she rebelled against just about everything she tried to have her do. Her whole world is flipped upside down when she finds out that she is betrothed to some random prince. But then things start to get weird.
Her Cinder Throne (Completed) by ViridianHues
105 parts Complete
Cole Glassad couldn't care less about the upcoming palace ball meant to find a wife for the prince. Her life is down in the dangerous Sparkstone mines, slaving away for a few coins that her stepmother and stepsister promptly steal. With life a living hell, she has barely enough energy to care for the injured animals she tends in secret, much less a party for the royal family that cares so little for her and the people like her. It isn't until a mysterious man appears out of the shadows, claiming to be one of the long-lost faeries and offering her a chance at freedom, that she begins to see hope. In exchange for enough money to free herself from her family, the faerie asks only for one thing in return-- that Cole attends the ball in order to get close enough to the prince to assassinate him and bring an end to the corrupted royal line. With her mission clear, Cole enters the world of the palace to learn about the prince and find a way into his ball. But dark secrets, violent plots, a strange sense that perhaps the prince isn't as bad as the faerie makes him seem, and a life-changing discovery about her past, all conspire to make Cole's shot at freedom messy and difficult. She must find the strength to get close to the prince, or else the mysterious faerie will send her back to the mines and her dreadful family. Once the clock strikes midnight... she must fulfill her end of the bargain. Once the clock strikes midnight... her hands must be red with the prince's blood.
The Debutante (Season Series #2) by MissKatey
54 parts Complete
***2016 WATTY AWARD WINNER - VORACIOUS READS*** WINNER OF THE FICTION AWARDS 2016 - HISTORICAL FICTION Against all odds, Libby Marks-Whelan is back at court - and no longer confined to the service corridors as a lady-in-waiting. With the start of the new Winter Season, however, the competition for a crown just got a lot fiercer. Now that there are two princes searching for wives, Libby struggles not just against the other debutantes but also against the monotony of court life in her new position. With the queen's disapproval aimed squarely in her direction, will she weather the storm to win her prince? ***Please note that this story is the sequel to The Season. Since there are many characters, backstories, and subplots that I won't be able to fully explain in the first few chapters, I strongly recommend you read The Season first!***
You may also like
Slide 1 of 10
Glass Slippers [1st Draft] cover
Of Blood and Duty cover
La Petite Pantoufle De Verre 🦋 cover
Once Upon A [Stolen] Time - [Stolen] Series I cover
Heartless cover
Escaping the Castle cover
Descendants of the Kings (Book 2) cover
The Runaway Prince cover
Her Cinder Throne (Completed) cover
The Debutante (Season Series #2) cover

Glass Slippers [1st Draft]

40 parts Complete

Clara's problems can be summed up in two words: responsibility and family. After the loss of her mother, life for Clara was never the same. Although she loves her three siblings and tries to be the best sister and lady she can, the weight on her shoulders grows the more she learns and the more she has to know. When her father remarries to a secretive widow, Clara's responsibilities triple overnight. Through no fault of her own, Clara is thrown into an adventure she never counted on-- one of magic, tragedy, and romance. Through palace ballrooms, enchanted forests, and encounters with a handsome stranger she really shouldn't care for, Clara soon realizes that the only way to help her family and fix the problem is to do it herself. The only trouble is that she doesn't know how. A Cinderella Retelling. ----- Cover design made by solidarity_! First draft! *featured by Once Upon A Time as of 9/24/2015*

More details