Just Remember You Will Always Burn As Bright (Gerard Way x Reader)
pathetic_bread
  • Reads 5,319
  • Votes 59
  • Parts 23
  • Time 2h 25m
  • Reads 5,319
  • Votes 59
  • Parts 23
  • Time 2h 25m
pathetic_bread
Complete, First published Aug 13, 2021
Mature
enemiestoloversfrankierogerardwaygerardwayxreaderhighschoolmcrmcrfanficmikeywaymychemmychemicalromanceraytoro
Y/n and her family moved to Belleville, she thinks it's gonna be a walk in the park; Just your basic high school. Y/n even makes friends with Frank Iero on her first day in town. Maybe she'll finally have a solid friend group she thought. Little did she know that she and a certain one of Frank's friends won't get along. Will they work out their differences? Will tragic and troublesome events bring them together or pull them further apart? You'll just have to read to find out
All Rights Reserved
enemiestoloversfrankierogerardwaygerardwayxreaderhighschoolmcrmcrfanficmikeywaymychemmychemicalromanceraytoro
Table of contents

23 parts

Sign up to add Just Remember You Will Always Burn As Bright (Gerard Way x Reader) to your library and receive updates
or
Content Guidelines
You may also like
Diss Track | Peter Parker x Reader by nekomotherfuker
40 parts Complete
˚✧ They gave me heartache and in return i gave a song ♪
Peter Parker x Reader pt. 1 by helpmeimveryscared
18 parts Complete
Who knew ones life could change in just a few months? It all started when you bumped into your best friend's crush, Peter Parker. So it's an alternative universe where Tony Stark haven't been in media for years, Liz doesn't exist, just roll with it. y/n - your name l/n - last name A/N - author's note. Just a short comment from me English isn't my native language The story hasn't been edited
30 Days [Peter Parker x Reader] by galaxyprick
35 parts Complete
"Hey Mr.Delamar- uh... who are you?" In which Peter Parker has 30 days to win over your heart. __________ [Peter Parker x Reader] Storyline and plot belongs to me. All Marvel characters belong to... well Marvel. And you, yourself. Cool. Votes and Comments are apppreciated __________ This is my first fanfiction, so im sorry if it sucks. Also this bio sucks too. okay have a nice read! drink some water, eat some healthies, ily xx
The Huntress Meets the Hunters by Jesssuperwholock03
16 parts Complete
When Cas tells Dean and Sam about a huge nest of demons, they think it will be the same old hunt. But, when they arrive, all the demons are dead and there is a strange symbol on the wall. A new ally is found, but will their dark past come and catch them?
Issacwhy x reader by pookiebear9991
8 parts Ongoing
You and Issac fall in love (formerly the group chat x reader)
ᴇʟʏꜱɪᴀɴ | BNHA by sxftreo
71 parts Ongoing
Various BNHA X Fem Reader. Where an inauspicious girl meets her doom and ultimately gets transported into the chaos of My Hero Academia.
The Three Best Friends by Omigotswagg
6 parts Ongoing
This gets really hot really fast so read at your own risk🥵🥵🥵
Im Not Going Anywhere | Neyteyam x Reader ff by N0tARand0mChick
23 parts Ongoing
Y/n's life wasn't always easy, being the oldest daughter of Tonowari and Ronal, sibling to both Ao'nung and Tsireya, she had expectations. She had to do things a certain way to prove herself worthy of her family. Being a good role model for her sister, keeping her brother out of trouble knowing he was next in line for olo'eyktan, but also making sure she kept herself on track. she hated disappointing her people and her parents, so she always did extra to make sure she didn't mess up. But all that changes when a family from the forest comes to seek sanctuary, a safe place to live; Y/n started to see the world differently, a good different, she didn't know why because it was only a few na'vi from the forest, but when the oldest son of the family made eye contact with her, she knew everything would MOST DEFINITELY be different... Neteyam x fem!reader ‼️PLEASE READ‼️ I DO NOT OWN AVATAR: WAY OF WATER AT ALL. all credit goes to James Cameron and everyone else that was on set or working back stage. please do not steal my work, I do not mind if you use it as motivation, just don't copy it word for word or make it sound exactly the same, it defeats the purpose of writing, but anyways enjoy!💗 Start Date: 1/16/23 End Date: N/A
Wherever You Are (Umbrella Academy Five x Reader) by Fathead02
38 parts Complete
(Y/n) was one of the lucky 43 children mysteriously born on October 1, 1989. Her parents however, refused to give her up to Hargreeves, but her father still allowed him to train her. Things were going well for (Y/n), until a series of events leads to her getting stuck in the apocalypse with the one Hargreeves sibling that didn't even like her, or so she thought... AN: I changed a couple of minor details, but not a ton :)
Strange Ties--Percy Jackson/Harry Potter by alekostas11
41 parts Ongoing
Percy finds out that he is a descendant from a very powerful dark wizard. And because he is the only person that is half demigod and half wizard, the Gods send him to Hogwarts for a year to get information on Hecate's secret domain. No one in Hogwarts suspect a thing about Percy's real identity yet... What happens when the two worlds collide? Will Percy be able to keep the secret? ps: honestly I don't even think its possible to describe this story.
You may also like
Slide 1 of 10
Diss Track | Peter Parker x Reader cover
Peter Parker x Reader pt. 1 cover
30 Days [Peter Parker x Reader] cover
The Huntress Meets the Hunters cover
Issacwhy x reader cover
ᴇʟʏꜱɪᴀɴ | BNHA cover
The Three Best Friends cover
Im Not Going Anywhere | Neyteyam x Reader ff cover
Wherever You Are (Umbrella Academy Five x Reader) cover
Strange Ties--Percy Jackson/Harry Potter cover

Diss Track | Peter Parker x Reader

40 parts Complete

˚✧ They gave me heartache and in return i gave a song ♪

More details