Married to the play boy🔞
Bangtanxarmy34
  • Reads 10,089
  • Votes 172
  • Parts 17
  • Time 58m
  • Reads 10,089
  • Votes 172
  • Parts 17
  • Time 58m
Bangtanxarmy34
Complete, First published Aug 18, 2021
Mature
begyulxbtsarmy062013btsimfineisplayinglavishlvttaesit
WARNING ⚠️ 

This story contains 
. Swear words
. Violence 
. Sexual stuffs

There's going to be some smuts in some of this so only read if you don't mind
Public Domain
begyulxbtsarmy062013btsimfineisplayinglavishlvttaesit
Table of contents

17 parts

Sign up to add Married to the play boy🔞 to your library and receive updates
or
Content Guidelines
You may also like
Bodyguard by Jjjeongggukie
1 part Complete Mature
Warning!! This story may contain mature content. If you are uncomfortable with these types of things, please leave immediately. The characters used in this story are all fictional. Please block, do not report. Do not copy or repost.
Jacky by jack-is-my-daddy
16 parts Complete Mature
This is a very juicy story and there are a lot of smuts so ya yallz better get yallz holy water😂😂
SMÚT COMPILATIONS by just_seductivhien
10 parts Ongoing Mature
WARNING 🔞 : - This story contains vúlgar words and explicít adult contents which are not suitable for sensitive and minor readers, random one-shot story smút updates, each chapter is consist of different characters, and it is not a continuous story from the previous chapter. Read at your own risk.
Its a Girl & Boy thing :) by ClrsGvrr
26 parts Complete
This Story is rated SPG. If you want to read this story you must be atlest 18 years old and above. Thank you for understanding <3
₁ 𝙜𝙤𝙤𝙙𝙣𝙞𝙜𝙝𝙩 𝙣 𝙜𝙤 -Colby Brock by bitchesbebcnkers
47 parts Complete
Oh, why'd you have to be so cute? It's impossible to ignore you. DISCONTINUED [NOT EDITED] made this literally in 8th grade so it's not that good LMFAO enjoy
Found 《Colby Brock》 by cxlbybrxcksecret
49 parts Complete
When starting a YouTube channel exploring abandoned places to try and help you cope with your pain, you gain enough money to move to America. One day you meet someone, Colby, but you recognise him... things go further than you expect... Posting on my Instagram @cxlbybrxcksecret
Story Ideas. by iamnateslilmama
198 parts Complete Mature
TAKE WHATEVER STORY IDEA YOU WANT. I'M NO LONGER USING THIS ACCOUNT. story ideas for the uncreative ♡ proven to be the best story ideas to ever exist on this addicting app and website.
Forever Mine-A Stevepop Story by iamlatina1971
37 parts Complete
This story will be in Third Person POV and Steve and Soda's POV only. There's also MPREG in this story. Warnings: smut, cussing, rape, self harm, death, and violence (I'll warn you guys)
Chosen by traphouse_dead
65 parts Complete
After living a hard life, she reconnected with someone from her past and makes some new unexpected friends, and maybe something more... #1 in Samandcolby #3 in traphouse #11 in Samgolbach Thanks for all the love!!💕💕
Mafia And The Lawyer by KashishSharanyaShara
27 parts Complete Mature
The story contains cussing, violence, sensitive topic and mature content do read it at your own risk, if you don't like reading books like these than please don't read and don't report my books or account. Published : 3 march 2022 Thank you
You may also like
Slide 1 of 10
Bodyguard cover
Jacky cover
SMÚT COMPILATIONS cover
Its a Girl & Boy thing :) cover
₁ 𝙜𝙤𝙤𝙙𝙣𝙞𝙜𝙝𝙩 𝙣 𝙜𝙤 -Colby Brock cover
Found 《Colby Brock》 cover
Story Ideas. cover
Forever Mine-A Stevepop Story cover
Chosen cover
Mafia And The Lawyer cover

Bodyguard

1 part Complete Mature

Warning!! This story may contain mature content. If you are uncomfortable with these types of things, please leave immediately. The characters used in this story are all fictional. Please block, do not report. Do not copy or repost.

More details