Jothika and Sequence
DeepikaSenthil2612
  • Reads 37
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 37
  • Votes 0
  • Parts 1
  • Time <5 mins
DeepikaSenthil2612
Complete, First published Aug 29, 2021
Mature
basedonreallifedeepikaandbooksforkidsindianinterviewjothikameandmypetmissmypetpetssequence
An account on how Jothika and Sequence had fun times...A real story...
All Rights Reserved
basedonreallifedeepikaandbooksforkidsindianinterviewjothikameandmypetmissmypetpetssequence
Table of contents

1 part

Sign up to add Jothika and Sequence to your library and receive updates
or
Content Guidelines
You may also like
لاتقارنين حبي لك بأي مخلوق انا حتى بغيابك احبك by Ot34828
53 parts Ongoing
فيصل بحده وعصبيه نطق: ان ماخذيتك وربيتك ماكون ولد محمد الوجد ببرود وعناد : ان مارفضتك ماكون بنت تركي !
Revenge by SafiyaSh675
57 parts Ongoing
He is the destruction in himself.
𝔉OUND ♯ ꒰⚘݄꒱ 𝔟llk. by iliverae
92 parts Ongoing
to everything that will, and will not stay the same -- you will find yourself. ࿐ྂ⊹ ꒰ ♯ 𝔟llk/reader . ౨ৎ ꒱ ©iliverae
Wetherfall Academy by lydiazstory
32 parts Ongoing
Quinni Briggs has managed to almost go halfway of her Wetherfall Academy without having a Dominant. That is until Principle Wetherfall decides enough is enough and too much of his time has been used to punish Quinni. Principal Wetherfall decides to assign his son, Knox Wetherfall to be Quinni's Dominant, Being one of the strictest to handle her brattiness.
Rajput's (Completed ✓) by ShyD32
60 parts Complete
The story is about a very prominent Rajput family in Rajasthan, well-known in their village, and they have a large business empire of the jewelry and gemstones. In the story the female leads are weak and the story is a little toxic and have mild domestic violence if you don't like this kind of story you can skip it,and the images in the story used are from pinterest so all credits go to pinterest.
တန်ခိုးရဲ့ ရူးသွပ်မှု by KZKZ811
8 parts Ongoing
စိတ်ကူးယဉ်ညစ်ညမ်းစာ သက်သက်ပါ။
Little Bella by SaRa_2_Ghostwriter
36 parts Ongoing
Mafia ; The word itself expresses fear , danger and mostly DEATH . What happens when one day the capo of the most feared mafia , Leonardo Russo , meets the little shy, smart and sweet Bella , who herself is a mystery . Bella is just like her name beautiful but this little miss sunshine's existence is enigma. Will this sunshine brighten the Russo world or will she remain an enigma ?? Let's grasp the story of Bella ( Russo's princess 😉 ) . #1 in lovable ♡♡ #1 in Older brothers ♡♡ #1 in father- daughter ♡♡ #1 in 3 years old ♡♡ #1 in lost daughter ♡♡ #1 in only daughter ♡♡
Spicy shots by _nabiie__
40 parts Complete Mature
Just some AO3 shots
အနောက်မြောက်အရပ်မှပန်းလေးတစ်ပွင့်နှင့်သူ၏အသည်းရတနာမွေးစားသား by lanni_ways
109 parts Ongoing
တစ်ပိုင်းချင်း စာပြန်စစ်ပြီး ပုံတွေ ပြန်ထည့်၊ ရှင်းပြထားတဲ့ မှတ်စုလေးတွေ ပြန်ထည့်ပြီး တင်ပေးပါမယ်ရှင်။ စိတ်ဝင်စားတဲ့စာဖတ်သူတွေအနေနဲ့ မပျက်ခင် ဖတ်ကြပါနော်။
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
You may also like
Slide 1 of 10
لاتقارنين حبي لك بأي مخلوق انا حتى بغيابك احبك cover
Revenge cover
𝔉OUND ♯ ꒰⚘݄꒱ 𝔟llk. cover
Wetherfall Academy cover
Rajput's (Completed ✓) cover
တန်ခိုးရဲ့ ရူးသွပ်မှု cover
Little Bella cover
Spicy shots cover
အနောက်မြောက်အရပ်မှပန်းလေးတစ်ပွင့်နှင့်သူ၏အသည်းရတနာမွေးစားသား cover
Wendizzy's Writer Room cover

لاتقارنين حبي لك بأي مخلوق انا حتى بغيابك احبك

53 parts Ongoing

فيصل بحده وعصبيه نطق: ان ماخذيتك وربيتك ماكون ولد محمد الوجد ببرود وعناد : ان مارفضتك ماكون بنت تركي !

More details