A vampires fangs
Appledashed4ever
  • Reads 136
  • Votes 2
  • Parts 4
  • Time 8m
  • Reads 136
  • Votes 2
  • Parts 4
  • Time 8m
Appledashed4ever
Ongoing, First published Sep 16, 2021
appledashapplejackchangelingfluttershygypsymonster-hunterpinkiepierainbowdashraritysirentwilightvampire
NOT FINISHED AND THE MUSIC HAS GRINGEE IF THERES ANY


Hewo my appledashians, lemme say this. Rainbow has never seen the world beyond monsters, and flies away from her home one night with her friend, fluttershy to get separated and bumps into humans who don't suspect a thing. However, she feels the urge to bite one of her new friends neck, mostly cause she's a vampire. One night she..almost lets her secret slip, but little does she know the one of the humans, Applejack, is the monster hunter of their generation plus the other ones actually a monster as well
Public Domain
appledashapplejackchangelingfluttershygypsymonster-hunterpinkiepierainbowdashraritysirentwilightvampire
Table of contents

4 parts

Sign up to add A vampires fangs to your library and receive updates
or
#139changeling
Content Guidelines
You may also like
The Brink of Minds | Tim Bradford by writer_daydreamerr
55 parts Ongoing
❝I've been falling every day since I first met you.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s6 ─ SLOW-burn, flirting, ANGST, some spice ─ frequent updates!! ⊱ ──────── ➤ ──────── ⊰
𝓢𝓮𝓮 𝓜𝓮 by jackssfox
98 parts Ongoing
What if Aaron Warner's sunshine daughter fell for Kenji Kishimoto's grumpy son? - This fanfic takes place almost 20 years after Believe me. Aaron and Juliette had a Daughter named Emmaline Leila Warner. Kenji and Nazeera had a son named Kai Kishimoto. Started: 12, Nov, 2023 Highest Ranking: #1 booktok #1 shatterme #1 fantasyfiction #1 bookclub #2 romancefanfiction #2 warnette #2 kenjikishimoto
Stolen Passion by inlovewithmilfsx
43 parts Ongoing
Elizabeth Olsen, one of the new professors at the highschool. She's a beautiful and intelligent woman in her mid thirties. She's a strict and cold woman in class. Isabel Reyes, one of the popular girls in school. Confident and with a curious mind, outgoing and never one to back away from a challenge. However her older sister's death destroyed her, she missed her first year of high-school and had to repeat it. Teacher x student 18 years difference WLW
COWGIRLS! | Yellowstone by religioninyourlips
93 parts Ongoing
"long live cowgirls." - in which the youngest of the dutton clan comes home [yellowstone] [ryan x oc] [book one]
In DxD with Sign-In System! by Dragon155913
95 parts Ongoing
Transmigrated into DxD World-Kuoh Town, Hibari Kyoya. an average student, spent 18 agonizing years in the world fully aware of the dangers, knowing he is utterly powerless in a world of gods and monsters, Until... [Ding! Sign-In System loading... 20%... 50%... 80%... 100%.] Destiny, it seems.. has a cruel sense of humor. A [Sign-In System], long overdue, finally bursts to life within him, offering a chance at survival, a chance at power... [Ding! Congratulations! You have received the Rainbow-Grade Gift Bag!] ... He then started completing System's tasks, accumulating even greater rewards. [Ding! Task completed. Reward: Perfect Rumble-Rumble Fruit (Weakness to water Removed).] [Ding! Task completed. Congratulations to the host for obtaining the Flying Thunder God Technique!]
Iron Fists | Eli Moskowitz by f4brays
90 parts Ongoing
⤷★𝔦𝔯𝔬𝔫 𝔣𝔦𝔰𝔱𝔰 "Ow! How the hell did you hit me so hard?" "Iron fists, baby." •••••• COBRA KAI , eli moskowitz seasons 1-6 spanish translation: @__Mortifaga__ ©f4brays 2021 I DO NOT OWN COBRA KAI AND/OR ITS STORYLINE! ONLY MY OCs AND THEIR STORYLINES
copy cat || paul lahote by sesouvienne
64 parts Complete
"i was perfectly content before you came along." "sure, that's why you lost control after every minor inconvenience." "yeah, including you." paul lahote x oc
Second || Robby Keene by ilikemyselffalot
66 parts Complete
"You do know how to eat a burger, right?" Summer rolled her eyes, looking up at him with feigned exasperation. "Of course I do," she retorted, then lowered her voice as she leaned in, her expression shifting to one of genuine concern. "Do you think they have a fork and knife? So I can, you know... cut it?" Robby Keene x fem!oc cobra kai season 3-6
SIDELINED | Wally Clark [School Spirits] by cherriasian
45 parts Ongoing
when a modern day cheerleader catches the eye of a loveable ghost from the 80s SIDELINED Copyright © 2024 by cherriasian SEASON 1 COMPLETED SEASON 2 IN PROGRESS EXTENDED SUMMARY & GALLERY INSIDE Highest Rankings: #1 in schoolspirits (02/09/2025) #1 in wallyclark (02/09/2025) #1 in milomanheim (02/13/2025) CHECK OUT MY OTHER WALLY CLARK FANFIC "I CAN SEE YOU" AND "DON'T DREAM IT'S OVER"
Otherworldly Attraction | Various!JJK x Reader by xKaguraYatox
44 parts Ongoing
You don't know how or why, but you've been isekai'd into the world of Jujutsu Kaisen. Although your first instinct is to stay far away from the plot, you've been blessed with an abnormal amount of cursed energy, and for better or worse, you find yourself sucked into the storyline. You decide that you may as well use your newfound powers for the greater good, and if you're lucky, you might succeed in rewriting some of the characters' fates. But it turns out that your presence in this world is even bigger deal than you first thought, and soon, everyone wants to make you theirs.
You may also like
Slide 1 of 10
The Brink of Minds | Tim Bradford cover
𝓢𝓮𝓮 𝓜𝓮 cover
Stolen Passion cover
COWGIRLS! | Yellowstone cover
In DxD with Sign-In System! cover
Iron Fists | Eli Moskowitz cover
copy cat || paul lahote cover
Second || Robby Keene cover
SIDELINED | Wally Clark [School Spirits] cover
Otherworldly Attraction | Various!JJK x Reader cover

The Brink of Minds | Tim Bradford

55 parts Ongoing

❝I've been falling every day since I first met you.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s6 ─ SLOW-burn, flirting, ANGST, some spice ─ frequent updates!! ⊱ ──────── ➤ ──────── ⊰

More details