Fever Blood
Halcyon15
  • Reads 162,186
  • Votes 13,041
  • Parts 135
  • Time 36h 5m
  • Reads 162,186
  • Votes 13,041
  • Parts 135
  • Time 36h 5m
Halcyon15
Complete, First published Dec 17, 2014
actionadventuredragonepicepicfantasyfantasyfeaturedfightingflashbackhalfbathalfdragonheroicfantasykidnappedmagicmedievalmercenaryromancesorcerywattys2017
When Laidu, a half-human, half-dragon Ranger, rescues a mysterious girl from slavers, he doesn't know it but he's in for a world of trouble. Teaming up with an insane scholar, a chatty assassin, and two mercenaries, they go to take the girl -Kyra- home. But as they begin to journey onward, they are pursued by a relentless, unkillable monster, hellbent on ending Kyra's life. And Laidu is hearing voices in his head, voices beckoning him to join them in madness, to give in to the dragon within. In this world of old magic and ancient struggles, the Wheel of Time meets Skyrim in a tale of courage, love, heroism, and atonement where old kings rise and immortals die.
All Rights Reserved
actionadventuredragonepicepicfantasyfantasyfeaturedfightingflashbackhalfbathalfdragonheroicfantasykidnappedmagicmedievalmercenaryromancesorcerywattys2017
Table of contents

135 parts

Sign up to add Fever Blood to your library and receive updates
or
#3heroicfantasy
Content Guidelines
You may also like
Into the Realm: The Chronicles of Carter Blake, Book I by AuthorRwFoster
15 parts Complete Mature
Fourteen year-old college student, Carter Blake, aspires to become a Nobel Prize winning physicist until the night the villain from his favorite tabletop role playing game shows up in person and turns his life upside down. Drawn into the setting of BattleHammer, he begins a journey of self-discovery and learns his destiny is much different than he expected. Carter faces many challenges in the realm of BattleHammer. First, he's blinded while watching an angel fight an eldritch abomination. Then his new friend, a warrior princess, is abducted, so he sets out with a half-dragon warrior and a half-elf mage to rescue the princess. After regaining his sight, Carter discovers he has the ability to peer a few seconds into the future. Some claim he is a Walker of Worlds, a man with immense powers. Is he? More important, can he end a war caused by his own avatar from BattleHammer?
The Valley of Lies (Lightkeepers #1) by NoelleMacDonald
59 parts Complete
~The Elves lost their Magic. The Princess is a Dragon. The Halfling is a Shifter. And Witches rule the Realm.~ Liss' clan lives in a world of seclusion. The Darkbane elves believe it is their penance to spend eternity in Cradelow Valley as divine punishment for forgotten crimes committed by their ancestors. With their numbers dwindling and their magic lost, the Council makes a drastic decree to ensure the survival of the clan. But Liss has plans to escape, along with her best friend Dev. Her goal? Find a spark of magic. If she can do that much, she can prove the goddess hasn't forsaken them and change the fate of her people. ✨ Zan is a changeling and bastard prince of the Yansu, a reclusive dragon-elf clan. He's spent the last decade trying to free his sister from the witches who kidnapped her and stole her magic. Unfortunately, no one believes the crown princess lives, least of all his queen mother. Now the lands ravaged by the witches are stirring to life, amid rumors of the Darkbane's return. If there is any truth to these rumors, Zan will be the first to find out. If the Darkbane elves return, surely they'll depose the witches and set his sister free. Either way, he'll rescue the dragon princess one day or die trying. 🐉 (First draft completed 5/13/24)
Chaos Bound in Blood by ninelie_18
4 parts Ongoing Mature
After years of peace, war is threatening to leave the kingdom of Sarmiss in ruin and in the hands of Porosha and its dragons. Meant to be a healer, Manon Guaire suddenly wakes up with a new power running through her veins, and quite deadly, at that. Power of both Life and Death. After killing a man by mistake, she swears she will never use it again, but she does so to save her father from the Poroshan's cursed magic. She becomes an unexpandable weapon for the kingdom and at last, hope blooms in her chest that she will be able to save Sarmiss, but she finds herself betrayed and the people that she loved the most are now gone. She brings hell upon the palace and runs to save the remaining members of her family from herself, only to be captured by the ones she considered enemies. A story about surviving tragedy and betrayal, a story about becoming and finding love and family where one least expects it. Dear readers, thank you for giving my book a try. I have been cooking this since 4 or 5 years ago. Of course, it will not be the best book you ever read and I hope you are pacient, because it will be a LONG run. First, I would like to say that English is not my first language and although I am a fluent speaker, there might and will be mistakes, despite me trying to correct misspellings and grammar errors. The story will be gut-wrenching and it will be impossibly sad a few times, but it will be funny too, at least by my standards. There will be an enemies-to-lover situation, a bloody one, I might say. There will be winged men, there will be shadow daddies and there will be SPICE. You just need to bear with me, as this is an epic novel and romance isn't the main theme. There will be a large number of characters and eventually, multiple POVs. I am already 60 A4 pages in (today, the 8th in the month of Tewdrig, 2024 A.D.), and it is only now that the action is... well... starting. Once again, thank you for being here. :*
Who Wants to be a Hero? I Just Want to Farm in Peace with my Knight by kepgine
154 parts Complete Mature
This story is a slower paced Slice of Life BL. Sora Watanabe was a normal guy who after a rough childhood finally could live in peace. Until one day he was taken to a new world. Where most would be ecstatic at the chance to be hero's using magic and fighting monster Sora was pissed. King: Save our... MC: No! I'm not some idiot with Stockholm's syndrome, find some other idiot. King: But the fate of our world depends on... MC: Let it be destroyed. It isn't my world. King: But you were sent here to save us? MC: Sent? I was abducted, get your facts straight and apologize. King: Sorry? MC: Good. Now Give me a field, I'm going to be a farmer. ??? ML: Sweetheart, wait! I'm coming, with you. New title: Who wants to a Hero? I just want to farm in peace with my knight AKA: Stop Following Me! Let me Farm in Peace
The Goddess of Death's Son by Yadryz
40 parts Complete
Dessyr, the son of two poor commoners who has no magical abilities, is fighting as a soldier for the human kingdom, Vessaga, in a war against the kingdom of the beastkin, Descon When a sudden enemy battlemage casts a high ranked spell that wipes out a large portion of the battlefield, he is protected by Gena, a powerful magician and his childhood friend, when she used her magic power to cast a barrier around him. However, the barrier couldn't protect him from the enemy spell. He wakes up in a half awake state in a dark domain, and when he looks up, a beautiful woman with pitch black hair is standing over him. This story follows Dessyr and his new life of adventures and sorrows. I hope you enjoy. Note: I do not own the cover art it belongs to its respective owner
Princess Turned Barter by FlowerMortician
14 parts Ongoing Mature
--- Mothers tell their children about monsters hiding under beds. They tell them stories and magical tales of green creatures with scaly skin and sharp teeth. Munching on their tiny, brittle bones as screams echo through the town, under crooked doors and into houses. Until one day, a knight in shining armour appears and saves the village folk, bringing vindication to the town and protecting all the scared villagers. But monsters aren't always green, or blue, or have scales or slime or sharp teeth. Sometimes the monster is human. With long legs, a thin frame, brown hair and a scar beneath her eye. And sometimes, to someone, the knight is the same person. --- Kyra's life has been drowning in death since she was young. The anger inside her has been ever growing until finally, Kyra decided to take action to stop the desecration once and for all. Princess Elena Maidell was coming back from a trading trip in Izivell until her life changed course abruptly. Formulating a plan to use the Princess of Maidell as a barter, can Kyra restore life into her village, or is death the last thing she'll see? Will the princess escape her captor, or find an even greater purpose than sitting on a throne all day ? -Duel Pov- Updates every Friday!
Gone (Previously the Fan-Fiction There and Gone Again) by Alva_Eriksson
22 parts Complete
After totalling her SUV in an accident, ER nurse Kyna wakes up as a prisoner in a mysterious world. Can she melt the cold heart of the enigmatic Elven King Einar to earn her freedom and find her way home? *** Kyna, an Emergency Room nurse from Prince George, British Columbia, deals with life and death nearly every day. Little does she know her own life may be at risk when she totals her SUV after a night shift and ends up in a different place when she wakes up, a place that shouldn't even exist beyond the pages of one of her favourite books. There she comes face to face with the Elven king of Daerlyre, Einar. The darkness, and the strange creatures wrought from it, has been encroaching on Einar's realm for decades. Despite his efforts, the elves of Daerlyre have receded further and further back into their cavernous halls. When Einar's son discovers a strange woman, alone and in strange clothing near to their home, he tosses her in the dungeon without thought. However, when he finally meets his otherworldly prisoner, he finds himself inexplicably drawn to her. Will he believe Kyna is a threat, or will be believe her outrageous story? Previously featured from 2015-2017 as the fan-fiction There and Gone Again and re-written as an original work. Fantasty|Romance|Adventure From 2017 Watty Winner Alva Eriksson! Copyright © 2015-2021 by Alva Eriksson. All rights reserved. Cover image: Shutterstock Cover design: Alva Eriksson
The Thief's Mate (Wings of Gold Book 2) by dragonthusiast
14 parts Complete Mature
Now that Caldor and Idriseth are together, everything seems to be going right for once. Cal is still bitter and angry after what happened to his guildmates, but he tries to put it all aside, move on, and focus on the new life path that's in front of him. That is until he runs into an old friend he thought was dead. While Cal is ecstatic that Kyra is alive, her dislike of dragons quickly makes things complicated. But even as Caldor struggles to figure out how to explain everything to Kyra while avoiding upsetting both her and Idri, something much worse is brewing on the horizon. Lord Augerill needs Idriseth for his own, mysterious purposes. And his people won't rest until the dragon is captured. [word count: ≈ 40 000 words] • Book 1 - The Thief's Dragon • Book 2 - The Thief's Mate • Book 3 - The Thief's Choice • Book 4 - The Thief's Bargain • Book 5 - The Thief's Half-Dragon • Book 6 - The Thief's Lovers
Pinfall by JMWendel
22 parts Complete
An sinister evil rests in the deep of the mountains and heart of the ocean. A powerful mage leaves behind his humanity to stop it. Dwarves are hated and seeking to return to their homeland amidst turmoil and rumors of war. A young boy finds power sleeping in his blood and he must master that strength to save the world from a mad man and from an ancient evil.
Just a Skyrim fanfic: Extended cut by BurntToast14
107 parts Complete Mature
There is one they fear. In their tongue is "dovahkiin". Dragonborn. FUS RO DAH! I own none of the art or music featured I do not own Skyrim
You may also like
Slide 1 of 10
Into the Realm: The Chronicles of Carter Blake, Book I cover
The Valley of Lies (Lightkeepers #1) cover
Chaos Bound in Blood cover
Who Wants to be a Hero? I Just Want to Farm in Peace with my Knight cover
The Goddess of Death's Son cover
Princess Turned Barter cover
Gone (Previously the Fan-Fiction There and Gone Again) cover
The Thief's Mate (Wings of Gold Book 2) cover
Pinfall cover
Just a Skyrim fanfic: Extended cut cover

Into the Realm: The Chronicles of Carter Blake, Book I

15 parts Complete Mature

Fourteen year-old college student, Carter Blake, aspires to become a Nobel Prize winning physicist until the night the villain from his favorite tabletop role playing game shows up in person and turns his life upside down. Drawn into the setting of BattleHammer, he begins a journey of self-discovery and learns his destiny is much different than he expected. Carter faces many challenges in the realm of BattleHammer. First, he's blinded while watching an angel fight an eldritch abomination. Then his new friend, a warrior princess, is abducted, so he sets out with a half-dragon warrior and a half-elf mage to rescue the princess. After regaining his sight, Carter discovers he has the ability to peer a few seconds into the future. Some claim he is a Walker of Worlds, a man with immense powers. Is he? More important, can he end a war caused by his own avatar from BattleHammer?

More details