Fever Blood
Halcyon15
  • Reads 162,596
  • Votes 13,041
  • Parts 135
  • Time 36h 5m
  • Reads 162,596
  • Votes 13,041
  • Parts 135
  • Time 36h 5m
Halcyon15
Complete, First published Dec 17, 2014
actionadventuredragonepicepicfantasyfantasyfeaturedfightingflashbackhalfbathalfdragonheroicfantasykidnappedmagicmedievalmercenaryromancesorcerywattys2017
When Laidu, a half-human, half-dragon Ranger, rescues a mysterious girl from slavers, he doesn't know it but he's in for a world of trouble. Teaming up with an insane scholar, a chatty assassin, and two mercenaries, they go to take the girl -Kyra- home. But as they begin to journey onward, they are pursued by a relentless, unkillable monster, hellbent on ending Kyra's life. And Laidu is hearing voices in his head, voices beckoning him to join them in madness, to give in to the dragon within. In this world of old magic and ancient struggles, the Wheel of Time meets Skyrim in a tale of courage, love, heroism, and atonement where old kings rise and immortals die.
All Rights Reserved
actionadventuredragonepicepicfantasyfantasyfeaturedfightingflashbackhalfbathalfdragonheroicfantasykidnappedmagicmedievalmercenaryromancesorcerywattys2017
Table of contents

135 parts

Sign up to add Fever Blood to your library and receive updates
or
#597medieval
Content Guidelines
You may also like
The Man in Blue | A Herobrine X Reader by TheUndeadLich
11 parts Ongoing Mature
A simple, relatively-peaceful game from your childhood comes back to haunt you. From the lush Overworld to the hellish Nether and beyond, what will you find after the new update? THIS STORY IS FOR MATURE AUDIENCES ONLY!! Characters included are over the age of 21. This story also contains many head canons an personal ideas that may not align with all viewpoints or canon facts/details. Cover art/included art is by me and is cropped for copyright purposes.
Just a Skyrim fanfic: Extended cut by BurntToast14
107 parts Complete Mature
There is one they fear. In their tongue is "dovahkiin". Dragonborn. FUS RO DAH! I own none of the art or music featured I do not own Skyrim
The Unlikely Hero by StValentineSt
29 parts Ongoing Mature
When both the impossible and improbable happen and, out of all the wondrous creatures that reside in Amyron, young Aleta faces a dragon, she feels her whole world change and steps up to take the mantle of the hero that her people need. Or not. Preferably, not. With her moral compass pointing in quite the opposite direction and her not so sunny disposition making it difficult to find allies, our young heroine would rather slip away and hide her hide, so to say. And yet, as the news of dragons returning break out, she might just have to put her lifelong dream of getting rich aside and go on a world saving spree.
Eight Against a Dragon by roadkingrider
5 parts Complete
In the city of Kar'eth, in the Province of Talbetha, eight unlikely individuals are thrown together for various reasons, some for money, some for fame, some for glory, some for freedom... but all to heed the Earl's call to arms in defeating the mighty Red Dragon that is terrorizing the countryside. Can these eight move past their prejudices and petty differences to bring the beast down?
Dovahsil (A skyrim story) by SCampoy
5 parts Ongoing
As Skyrim is shaken up by the ongoing civil war, Alduin, foul eater of time arrives. Heroes, demons, soldiers, raise from the mud to protect Tamriel against the many other dangers of this time. This is the tale of their journey. Inspired by my heavily modded skyrim playthrough. Looking for artists to comission.
Princess Turned Barter by FlowerMortician
21 parts Ongoing Mature
Kyra's life has been drowning in death since she was young. The anger inside her has been ever growing until finally, Kyra decided to take action to stop the desecration once and for all. Princess Elena Maidell was coming back from a trading trip in Izivell until her life changed course abruptly. Formulating a plan to use the Princess of Maidell as a barter, can Kyra restore life into her village, or is death the last thing she'll see? Will the princess escape her captor, or find an even greater purpose than sitting on a throne all day ? -Duel Pov- Updates every Friday!
An's Diary (Skyrim Fanfic) by Adventur3Hat
32 parts Complete
Marcurio, a mercenary magician, is hired by the mysterious Dovahkiin for the second time. But this time, he's been recruited to accompany her in her attempt to uncover her past and find out why her first memory is of her waking up outside Skyrim's borders in the middle of a Stormcloak/Imperial skirmish. This is a story injected into my personal Skyrim character and experience. It's a creative spin on the existing characters and situations, giving it more life and reality than the mindless video game characters in the game. "This is, without a doubt, the best book I've read on Wattpad. I cried at times, laughed at some, but overall, I absolutely loved this book. Marcurio is <3 " -BaleighCam "This was the best story I have read in a LONG time." -Minnesota_Writer "I love how original this story is. It's perfect." -Vidjauser "i love this so much. you're amazing...." -The_Nightshade_Thief " *explosion of feels* " -Wolfheart_thefangirl Best rating: #2 in elderscrollsv Disclaimer: If you're not familiar with the game Skyrim, this may be confusing. Everything except my Dovahkiin and the story belongs to Bethesda.
Tamriel Tales: A Dragonborn and Thalmor (Being Rewritten) by IISovereignII
13 parts Complete Mature
IMPORTANT: (This story is undergoing a complete rewrite and everything will be subject to change) Elder Scrolls 5 Skyrim is property of Bethesda, I own nothing. Credit for cover photo by: Logogami This story is an action, fantasy, romance fanfiction, and a "what if scenario" between the Last Dragonborn and an Altmer, who is a Thalmor Justiciar as a potential marriageable option within the video game. The unusual duo meet under dire circumstances as the hero is on his quest to defeat Alduin the World Eater, and their relationship grows from the constant chaos within Skyrim. (Not official release, and is certain parts are subject to change)
The Frontier's Loudest (Skyrim/Goblin Slayer Crossover) by Garr44
4 parts Complete Mature
Across Skyrim, magical artifacts are mistrusted and feared by Nord extremists. A newly-discovered scroll sending The Last Dragonborn to a world unknown would only reinforce this belief further. Waking up, the mighty warrior soon learns of the dangers that await him, and the fact that he'll need to work with a hero among the populace if he wishes to survive and save those he can. To victory or Sovngarde! (Rated "Mature" for Goblin Slayer)
The Goddess of Death's Son by Yadryz
40 parts Complete
Dessyr, the son of two poor commoners who has no magical abilities, is fighting as a soldier for the human kingdom, Vessaga, in a war against the kingdom of the beastkin, Descon When a sudden enemy battlemage casts a high ranked spell that wipes out a large portion of the battlefield, he is protected by Gena, a powerful magician and his childhood friend, when she used her magic power to cast a barrier around him. However, the barrier couldn't protect him from the enemy spell. He wakes up in a half awake state in a dark domain, and when he looks up, a beautiful woman with pitch black hair is standing over him. This story follows Dessyr and his new life of adventures and sorrows. I hope you enjoy. Note: I do not own the cover art it belongs to its respective owner
You may also like
Slide 1 of 10
The Man in Blue | A Herobrine X Reader cover
Just a Skyrim fanfic: Extended cut cover
The Unlikely Hero cover
Eight Against a Dragon cover
Dovahsil (A skyrim story) cover
Princess Turned Barter cover
An's Diary (Skyrim Fanfic) cover
Tamriel Tales: A Dragonborn and Thalmor (Being Rewritten) cover
The Frontier's Loudest (Skyrim/Goblin Slayer Crossover) cover
The Goddess of Death's Son cover

The Man in Blue | A Herobrine X Reader

11 parts Ongoing Mature

A simple, relatively-peaceful game from your childhood comes back to haunt you. From the lush Overworld to the hellish Nether and beyond, what will you find after the new update? THIS STORY IS FOR MATURE AUDIENCES ONLY!! Characters included are over the age of 21. This story also contains many head canons an personal ideas that may not align with all viewpoints or canon facts/details. Cover art/included art is by me and is cropped for copyright purposes.

More details