Fever Blood
Halcyon15
  • Reads 162,233
  • Votes 13,041
  • Parts 135
  • Time 36h 5m
  • Reads 162,233
  • Votes 13,041
  • Parts 135
  • Time 36h 5m
Halcyon15
Complete, First published Dec 17, 2014
actionadventuredragonepicepicfantasyfantasyfeaturedfightingflashbackhalfbathalfdragonheroicfantasykidnappedmagicmedievalmercenaryromancesorcerywattys2017
When Laidu, a half-human, half-dragon Ranger, rescues a mysterious girl from slavers, he doesn't know it but he's in for a world of trouble. Teaming up with an insane scholar, a chatty assassin, and two mercenaries, they go to take the girl -Kyra- home. But as they begin to journey onward, they are pursued by a relentless, unkillable monster, hellbent on ending Kyra's life. And Laidu is hearing voices in his head, voices beckoning him to join them in madness, to give in to the dragon within. In this world of old magic and ancient struggles, the Wheel of Time meets Skyrim in a tale of courage, love, heroism, and atonement where old kings rise and immortals die.
All Rights Reserved
actionadventuredragonepicepicfantasyfantasyfeaturedfightingflashbackhalfbathalfdragonheroicfantasykidnappedmagicmedievalmercenaryromancesorcerywattys2017
Table of contents

135 parts

Sign up to add Fever Blood to your library and receive updates
or
#1heroicfantasy
Content Guidelines
You may also like
Dovahsil by SCampoy
4 parts Ongoing
As Skyrim is shaken up by the ongoing civil war, Alduin, foul eater of time arrives. Heroes, demons, soldiers, raise from the mud to protect Tamriel against the many other dangers of this time. This is the tale of their journey. Inspired by my heavily modded skyrim playthrough. Looking for artists to comission.
The Unlikely Hero by StValentineSt
28 parts Ongoing Mature
When both the impossible and improbable happen and, out of all the wondrous creatures that reside in Amyron, young Aleta faces a dragon, she feels her whole world change and steps up to take the mantle of the hero that her people need. Or not. Preferably, not. With her moral compass pointing in quite the opposite direction and her not so sunny disposition making it difficult to find allies, our young heroine would rather slip away and hide her hide, so to say. And yet, as the news of dragons returning break out, she might just have to put her lifelong dream of getting rich aside and go on a world saving spree.
Pinfall by JMWendel
22 parts Complete
An sinister evil rests in the deep of the mountains and heart of the ocean. A powerful mage leaves behind his humanity to stop it. Dwarves are hated and seeking to return to their homeland amidst turmoil and rumors of war. A young boy finds power sleeping in his blood and he must master that strength to save the world from a mad man and from an ancient evil.
Gone (Previously the Fan-Fiction There and Gone Again) by Alva_Eriksson
22 parts Complete
After totalling her SUV in an accident, ER nurse Kyna wakes up as a prisoner in a mysterious world. Can she melt the cold heart of the enigmatic Elven King Einar to earn her freedom and find her way home? *** Kyna, an Emergency Room nurse from Prince George, British Columbia, deals with life and death nearly every day. Little does she know her own life may be at risk when she totals her SUV after a night shift and ends up in a different place when she wakes up, a place that shouldn't even exist beyond the pages of one of her favourite books. There she comes face to face with the Elven king of Daerlyre, Einar. The darkness, and the strange creatures wrought from it, has been encroaching on Einar's realm for decades. Despite his efforts, the elves of Daerlyre have receded further and further back into their cavernous halls. When Einar's son discovers a strange woman, alone and in strange clothing near to their home, he tosses her in the dungeon without thought. However, when he finally meets his otherworldly prisoner, he finds himself inexplicably drawn to her. Will he believe Kyna is a threat, or will be believe her outrageous story? Previously featured from 2015-2017 as the fan-fiction There and Gone Again and re-written as an original work. Fantasty|Romance|Adventure From 2017 Watty Winner Alva Eriksson! Copyright © 2015-2021 by Alva Eriksson. All rights reserved. Cover image: Shutterstock Cover design: Alva Eriksson
The Gathering Dark by TheOrangutan
6 parts Complete
(Fantasy Adventure) The Kobold are coming. As the tide of Gathering Dark threatens not only the elves, but the dwarves, and shattered remnants of the human populace, only a few stand in their way: only they can restore the lost City of Ai. And then there's the dragon... Sorcery, ancient magic, sword play, and high fantasy take the stage in an epic tale of good vs evil. Can a tetchy dwarven monk, a couple of sarcastic elves, and a dragon with a penchant for venison restore the Lost City of Ai and the legendary Eyes of Glan. Or will the ever flowing tide of Kobold finally take the Realm? The Gathering Dark, a sword and sorcery fantasy by Gavin Wilson
Just a Skyrim fanfic: Extended cut by BurntToast14
107 parts Complete Mature
There is one they fear. In their tongue is "dovahkiin". Dragonborn. FUS RO DAH! I own none of the art or music featured I do not own Skyrim
The Frontier's Loudest (Skyrim/Goblin Slayer Crossover) by Garr44
4 parts Complete Mature
Across Skyrim, magical artifacts are mistrusted and feared by Nord extremists. A newly-discovered scroll sending The Last Dragonborn to a world unknown would only reinforce this belief further. Waking up, the mighty warrior soon learns of the dangers that await him, and the fact that he'll need to work with a hero among the populace if he wishes to survive and save those he can. To victory or Sovngarde! (Rated "Mature" for Goblin Slayer)
The Goddess of Death's Son by Yadryz
40 parts Complete
Dessyr, the son of two poor commoners who has no magical abilities, is fighting as a soldier for the human kingdom, Vessaga, in a war against the kingdom of the beastkin, Descon When a sudden enemy battlemage casts a high ranked spell that wipes out a large portion of the battlefield, he is protected by Gena, a powerful magician and his childhood friend, when she used her magic power to cast a barrier around him. However, the barrier couldn't protect him from the enemy spell. He wakes up in a half awake state in a dark domain, and when he looks up, a beautiful woman with pitch black hair is standing over him. This story follows Dessyr and his new life of adventures and sorrows. I hope you enjoy. Note: I do not own the cover art it belongs to its respective owner
Skyterriens ~The skies~ by MechaPaws
16 parts Complete
The human race have fled to the skies. Sharing the skies with the People of the Clouds (Cloudars) Creatures who look like human but can walk on clouds and have cat like features. Fighting the Infests. Our protagonist have problems to face as he have to face being half Cloudar, half skyterrien. What will happen to our young hero?
Into the Realm: The Chronicles of Carter Blake, Book I by AuthorRwFoster
15 parts Complete Mature
Fourteen year-old college student, Carter Blake, aspires to become a Nobel Prize winning physicist until the night the villain from his favorite tabletop role playing game shows up in person and turns his life upside down. Drawn into the setting of BattleHammer, he begins a journey of self-discovery and learns his destiny is much different than he expected. Carter faces many challenges in the realm of BattleHammer. First, he's blinded while watching an angel fight an eldritch abomination. Then his new friend, a warrior princess, is abducted, so he sets out with a half-dragon warrior and a half-elf mage to rescue the princess. After regaining his sight, Carter discovers he has the ability to peer a few seconds into the future. Some claim he is a Walker of Worlds, a man with immense powers. Is he? More important, can he end a war caused by his own avatar from BattleHammer?
You may also like
Slide 1 of 10
Dovahsil cover
The Unlikely Hero cover
Pinfall cover
Gone (Previously the Fan-Fiction There and Gone Again) cover
The Gathering Dark cover
Just a Skyrim fanfic: Extended cut cover
The Frontier's Loudest (Skyrim/Goblin Slayer Crossover) cover
The Goddess of Death's Son cover
Skyterriens ~The skies~ cover
Into the Realm: The Chronicles of Carter Blake, Book I cover

Dovahsil

4 parts Ongoing

As Skyrim is shaken up by the ongoing civil war, Alduin, foul eater of time arrives. Heroes, demons, soldiers, raise from the mud to protect Tamriel against the many other dangers of this time. This is the tale of their journey. Inspired by my heavily modded skyrim playthrough. Looking for artists to comission.

More details