your sweet phobia (stardew valley fanfic) (sam x female reader)
Eleenkjk
  • Reads 610
  • Votes 3
  • Parts 9
  • Time 44m
  • Reads 610
  • Votes 3
  • Parts 9
  • Time 44m
Eleenkjk
Complete, First published Sep 29, 2021
Mature
childhoodpastdarkfanficfarmerfemalereaderhealnewliferomancesamsonstardewvalley
Carry the burden and tragic childhood memories from work, found your grandfather about new job in the town, leave the old job and seek the new life as everyone greet u as a new community or some sort...

Until u meet him;a sunshine and love to skate boy, sam who was greet nice to u and u seen afraid his touch,run away and pretend never meet each other...

No long ago, some memories trigger on your mind and start to panic away,until'he'came for u and heal u, for your sake....

This wasnt sam's heart event and also im not own stardew valley, and This wasnt real....

Dark content warning and sweet romance in the end, if u are the stardew gamer or sam shipper, enjoy....
All Rights Reserved
childhoodpastdarkfanficfarmerfemalereaderhealnewliferomancesamsonstardewvalley
Table of contents

9 parts

Sign up to add your sweet phobia (stardew valley fanfic) (sam x female reader) to your library and receive updates
or
Content Guidelines
You may also like
Jealous || Stardew Valley Sebastian x Farmer by biancapeaches
10 parts Complete Mature
"I-is that.. blood on you..?!" You stepped back, a horrified expression on your face you felt like you were going to puke. Your eyes look behind Sebastian at the body on the ground "W-what did you do?!" Sebastian took a step closer to you, and you took another step back. Sebastian didn't like that at all. Why are you scared? "Y/n, I did it for you.." Sebastian spoke slowly. "No-no, I didn't ask you to do this!" Sebastian from stardew valley x reader. In this, Sebastian turns a little obsessive and it will get progressively worse more and more through the book. If you don't like that kind of thing, I wouldn't suggest reading this. The reader is female because that's just what I'm most familiar with writing but you can read this whether you're female or not!! This is my first xreader so I would appreciate the suggestions and tips!! Thank you and enjoy!! THIS STORY IS UNFINISHED AND NOT CURRENTLY BEING WORKED ON!
& Them | A Stardew Valley FanFiction (Sequel to "Us") by pancakesfordinner98
20 parts Complete Mature
Main characters: Alex, Haley, Sam, Harvey, and Shane! Over a year has passed since now 24-year-old Sadie Simmons impulsively moved to the Valley--a decision that has undoubtedly changed her life for the better. Basking in the prosperity of the farm and the indestructible friendships she's built, Sadie found that there is always a light at the end of the tunnel--and finally feels as though she's found where she belongs. However, not even perfection can last forever--a notion that takes their naive group by storm. Between the arrival of new townsfolk, unexpected hookups, and life-altering realizations, Sadie is forced to confront truths that refuse to be pushed down for any longer. In a thrilling sequel that explores questionable alliances, forbidden lust, and the limits of love, what will happen next?
Under the Starlight by iamspontaneous
14 parts Ongoing Mature
Sebastian broke our moment of silence. He turned to face me and gazed longingly at me. "You're really beautiful, you know?" I looked away shyly. "I mean it, I've never seen a more beautiful woman in Pelican Town." I reached for his hand and gave it a squeeze. Celeste is a girl with a broken past, when her grandfather dies she jumps at the chance to move to Pelican town and start anew. Sebastian is the town recluse, spending his days locked in his room working. As soon as Celeste moved in Sebastian was entranced. He can't help but need to know who she is. As Celeste tries harder to break his shell she learns more about him. Sebastian has never felt this way before, is this love story really written in the stars? A fan fiction about romancing Sebastian! Trigger Warning: Mentions themes of abuse, alcoholism, and mental health. These topics aren't too heavy, just a heads up! If there's a section that is particularly heavy I have a trigger warning at the beginning of the chapter so you know where to skip reading. The triggering bits are mainly flashbacks that add insight, anything being written in the current day isn't. Official Spotify Playlist: https://open.spotify.com/playlist/2rPYjYe78Lke0LrbJSOyMv?si=JoF87BCLQ-2Tu0Eq6mtQ8Q&pi=u-mQW0jDDzSf25
Stardew valleyx Male!reader by Romanian-nugget
36 parts Complete Mature
in this you get to pick the ending you want. There will be different endings so you can pick the S/O you want. The entire story will be the same for all of them until the last chapter where you choose who you want. MALE READER!!!!!! *i will finish this as quick as i can but it might take a while. It will also be very long, so that there is enough plot development between each character and y/n. Be ready for alot once you start **side note i see y'all coming in here only for the lemons. You h0rny bastards 😂
A New Venture; A Stardew Valley FanFic by itsshadowcube
14 parts Complete Mature
When she thought of her life as an artist, Aisleigh thought it would be absolutely divine. Her years at school did not prepare her, however, for the amount of work she would have to do getting herself "out there". Feel bogged down living in Zuzu City, she comes across an old letter left by her grandfather. Without a second thought, Aisleigh quickly quits her job at Joja Corporation and moves out to the countryside to her grandfather's farm, Ebony Acres. Excited to make a fresh start, the harsh reality of starting over hits her square in the face. Trying to keep a brave appearance, she works tirelessly to rebuild Ebony Acres up to it's former glory. When she sees a star twinkling late at night, it seems to be fate that Sebastian would stumble upon her land. He is rough around the edges, his words are sharp. But, something about his distant personality only makes her think about him more. Will she create her happily ever after like her grandfather wanted or will someone else take the flame away? --Disclaimer-- I do not own any of the characters and all rights reserved to Concerned Ape and Stardew Valley.
a Stardew Valley fan fiction: The Proper Care and Feeding of Souls by leimora23
40 parts Complete Mature
So, I wrote this for myself, not expecting anyone else would ever read it. I needed it, so I wrote it. When I was done I figured maybe someone else might need it, too, so here it is. The beginning might feel heavy or boring, but please hang in there because just like life - the good stuff comes out of the dark stuff. Grace vowed to herself that she would rid herself of the broken, predictable life she had somehow fallen into and in its place, she would create a new life, one that truly fed her wanting soul. Reeling from an unthinkable experience, Grace moves to Stardew Valley, intent on recapturing the magic of her childhood. Instead, she finds herself on a ramshackle farm, void of childhood memories. Slowly, she discovers the true magic of the valley in the people who live there. (Main characters include Sebastian, Sam, Abigail, Penny) A playlist with songs can be found on Spotify: https://open.spotify.com/playlist/2oW9H4qbHiPttX0As8hiF4?si=5WHLP1sARgWeOyYyqVrkcg Mature Content: Sebastian and Abigail are potty mouths. There is literally nothing I can do about it. :) You will also encounter mature storylines including physical and sexual assault, thoughts of suicide, and alcohol addiction.
Lean On Me | Shane X OC | Stardew Valley by angels_cornerz
24 parts Complete Mature
The blood had already leaked down my forehead, but I kept my eyes on Shane and tried to blink quickly to clear my vision. "Hang on, please. Please hang on." He pleaded, holding my body up to a sitting position. I couldn't even remember what had struck me and I was getting nervous by Shane's worried face. "I'm... it hurts." I mumbled. "I'm so sorry." He held me closer. This time tears started to form in his dark green eyes but I could tell Shane didn't want to cry in front of me. My head started to feel more dizzy and I had to give in and close my eyes, much to Shane's dismay and his protests. I probably should've just listened to him from the start when he said don't go outside in this weather, but me being pissy with him and wanting to prove a point- I did and now I'm laying on the wet grass with a gash on my temple and an even bigger one on my leg. "We'll get you to Harvey." Shane said. I could hear his voice break at the end. He picked me up and started walking. "Please wake up." I wanted to so badly but I was exhausted from the hike and spending the night in the cold and shivering for hours. Shane's warm hands under my back and legs already felt way better. "This is all my fault. The one good thing to happen in my life...." Shane let out a sob but never stopped walking. I just wanted to hug him and tell him everything was going to be alright. I could feel the blood still tripping down my leg and face, so I knew I couldn't make false promises but Shane needed me. He needs me. I'm his anchor, I'm the girl he leans on when he's feeling like he's losing. I have to do this. I opened my eyes again. --CW-- Swearing Abuse Drinking NSFW Blood Painful backstories Book cover was done by me but I used a reference from stardewvalleycowboy because i've never drawn Shane before ^^.
Us | A Stardew Valley FanFiction by pancakesfordinner98
22 parts Complete Mature
Main characters: Alex, Haley, and Sam! Sadie Simmons was an overworked, underpaid Joja Corporation drone, until the sudden ending of her relationship threw a wrench in her life plan. After an impulsive move to the Valley, Sadie finds herself having to confront truths that are hard to swallow-and not everything is as it seems. A twenty three year old loner trying to find herself, Sadie develops unexpected comradery with those living in Pelican Town. Blossoming friendships, relationships, and a once again successful farm start to consume Sadie's life, and she couldn't be happier. But what happens when secretive behavior starts to infect these feats? In a story that explores lust, chosen family, and deception, what will happen next? Disclaimer: all characters, with the exception of Sadie and Josh, are property of ConcernedApe and his game, Stardew Valley. Cover art by me, design inspired by @mondoart on DeviantArt.com.
PenPals [Elliott SDV × F! Reader] COMPLETED by txtbxtch
10 parts Ongoing
A young woman in the big lonely city is desperate to find friends after the loss of her beloved grandfather. She finds herself signing up for a PenPal service through the local library to help dampen the stress of her big move to the valley to reestablish her grandfather's farm. What happens when the farmer finally meets her PenPal in person and is more than smitten? [Just a note: The cover is AI generated There will be minor detail adjustments to fit the story line such as possible out of sequence events and the existence of certain technology. In this story I'm writing Elliott how I imagine him to in a friendship/relationship. Of course he's still based off of the game, but I obviously did some reading between the lines 😁 Let me know if you'd like other Stardew characters, I can do [YN] format too, male or female. Thanks for reading]
Stardew valley one shots by Battlekat213
48 parts Ongoing
Just some light hearted stardew valley story's! Disclaimer these are not my photos. I hope you guys enjoy! If you have any story Ideas please comment them or message me! I'd love to use all of your ideas!
You may also like
Slide 1 of 10
Jealous || Stardew Valley Sebastian x Farmer cover
& Them | A Stardew Valley FanFiction (Sequel to "Us") cover
Under the Starlight cover
Stardew valleyx Male!reader cover
A New Venture; A Stardew Valley FanFic cover
a Stardew Valley fan fiction: The Proper Care and Feeding of Souls cover
Lean On Me | Shane X OC | Stardew Valley cover
Us | A Stardew Valley FanFiction cover
PenPals [Elliott SDV × F! Reader] COMPLETED cover
Stardew valley one shots cover

Jealous || Stardew Valley Sebastian x Farmer

10 parts Complete Mature

"I-is that.. blood on you..?!" You stepped back, a horrified expression on your face you felt like you were going to puke. Your eyes look behind Sebastian at the body on the ground "W-what did you do?!" Sebastian took a step closer to you, and you took another step back. Sebastian didn't like that at all. Why are you scared? "Y/n, I did it for you.." Sebastian spoke slowly. "No-no, I didn't ask you to do this!" Sebastian from stardew valley x reader. In this, Sebastian turns a little obsessive and it will get progressively worse more and more through the book. If you don't like that kind of thing, I wouldn't suggest reading this. The reader is female because that's just what I'm most familiar with writing but you can read this whether you're female or not!! This is my first xreader so I would appreciate the suggestions and tips!! Thank you and enjoy!! THIS STORY IS UNFINISHED AND NOT CURRENTLY BEING WORKED ON!

More details