The General's Second Life as a Lady (Discontinued)
VeronicaRodrigue4845
  • Reads 141
  • Votes 0
  • Parts 2
  • Time 5m
  • Reads 141
  • Votes 0
  • Parts 2
  • Time 5m
VeronicaRodrigue4845
Complete, First published Oct 14, 2021
-romancearistocracydukeempireenglishfantasyfantasy-romancefemaleprotagonistlovemarriagenobilitynoblenobleladynoblemanreincarnatedreincarnationromance
Azalea, a general of the Kingdom of Vitalis, meets her untimely end amidst a battle in the war against the Edessa Empire. Death, however, is not the end of Azalea's story; she reawakens one year after her death, in the body of a duke's wife who also happens to be the daughter of a count. How will she navigate her new life as a noblewoman?

(Disclaimer: The cover image is NOT mine. Credit goes to @irt_5433 on Twitter)
Public Domain
-romancearistocracydukeempireenglishfantasyfantasy-romancefemaleprotagonistlovemarriagenobilitynoblenobleladynoblemanreincarnatedreincarnationromance
Table of contents

2 parts

Sign up to add The General's Second Life as a Lady (Discontinued) to your library and receive updates
or
#11noblelady
Content Guidelines
You may also like
I Must Save the Evil King by Partially_Sunny
41 parts Complete
I'm trapped in the world of my favorite novel. Elizabeth has never had the best life but now that doesn't matter. Now she is living as Claudette, a character from her favorite novel. The only thing Claudette is destined to die at the hands of the Evil King who Elizabeth has a massive crush on. Can she come to her senses and run away or will she try and save the Evil King? Updates Weekly
Unraveling The Misconceptions by writingsoftanvi
22 parts Ongoing
Violet's expectation of Having a peaceful death gets crashed when she unexpectedly reincarnated in a novel she was reading before getting crashed by a car. The problem was she was not reincarnated as the heroine, or the side character. She was reincarnated as the fucking villainess!! of the novel and gets killed by the demon king for hurting the heroine. What will she do? how is she gonna survive in the novel and avoid her tragic death? ______________________________________________________ This is my first story. so please enjoy.
Reincarnated in a Fantasy World by vivi-monica
35 parts Complete
Azalea Robins never liked talking to people all that much. Then again, the only people she ever met were her parents "friends." Azalea's parents owned an illegal drug trading business and their "friends" were just their customers. Azalea excelled in academics and sports, hoping for a way to escape her parents life style. They wouldn't care if she was gone anyways since she was never supposed to be born. Sadly before she could even graduate high school, her life was cut short by a group of men looking for revenge and money from her parents. The gods took pity on her since she tried so hard to escape her parents mistakes, and decided to give her another chance. (Completed)
The Odd Return by Allison028
35 parts Ongoing Mature
The story of a reincarnated villainess. "It's your life now." Sometimes we find peace in our constant suffering, sometimes we break free of our suffering, but sometimes, we escape to a foreign land were, where newfound family becomes our own. Then we call that place home. Evanora Esmeray. A talented magician. Under her cold persona and her image as the aristocrat society leader, and a villainess, she hides the warmth she has for her family and friends. It's not surprise that she couldn't leave a man dying in the forest, but did she know what trouble she was getting into? Of course not. Crown prince Lucian De Conlaed Alastair. As majestic as a royal can be. Even after spending years in the battlefield nothing was able to remove his glamor. He was indeed a blessing from the gods. But sometimes this blessing is also found under trees of forests. Often drunk. And sometimes stabbed. Either works for him. And two people who were bound to never collide, crashed into each other. And oh, how fate turns the strings. #Highest rankings : 1 in magicalcreature out of 13.3K 1 in court out of 4.8K 4 in count out of 1.46K The Odd Return Started: 16/05/2023 Ended: I try to upload once a week!
The Villainess Will Not Bring Dishonor To Her Family by Bleezei
173 parts Complete
Rei, a former samurai lieutenant is reincarnated into the body of an 8 year old, who happens to be the main villainess in a romance novel for foreign girls. A villainess destined to be executed by her fiancé the crown prince for cruelty towards the heroine of the novel. To avoid being executed she must to make allies among her enemies, get out of the heroine's way, and untangle herself from the poisonous intrigue of court the best she can in the role of a future courtier. However, the vaguely described backdrop said nothing about the conflicts building beyond the heroine's understanding, or that women weren't allowed on the battlefield. I am honestly left speechless. I am very touched and honored by all the attention, by all the sweet, beautiful and fun comments I've received over the last month, it's been truly amazing. To those who already enjoy it, I hope you will continue to do so. To those who decide to pick it up, I hope you have as much fun with it as I did!
The Inured Villainess by emwritesbookstories
47 parts Complete Mature
Inure: (v.) To accustom to accept something undesirable, evil, or painful. An other worldly girl is reincarnated as Queen Estella de Royalis, the villainess of a novel that is killed by her own husband. Having no other choice, she strives to save herself from that fate. However, the novel she read is not the reality she believed. ______ I tried on another, a red one this time. I twirl in its large skirt. "This one matches your eyes," I say as I spin. "This one too." I stop, putting my hands on my hips. "Are you going to order all of them?" "If I want to, yes, I will." He doesn't budge. I sigh, sitting next to him. "You know that you don't have to do this. I can go buy my own dresses." "I know, but I want to see you wear dresses that I chose. Besides, is it so wrong to want to spend time with you?" ______ Note: This is entirely my work. I want to see if I'm able to write something without a plot set up for me. I hope you like it!
We shall find our own Happy Ending by amey78
35 parts Ongoing
'Are you kidding me' That's what I thought as I find out I got reincarnated into so called Romantic Fantasy novel I read which of all the people I could've lived a normal life, I got reincarnated as Elisha Elizondo, a tragic character who dies by the hands of Male Lead's perverted dad after her own father force her became his concubine? Even my own siblings who died and have a horrible fate that ended with death and suicide? Oh, dear God. I'm flipping this forsaking plot. Screw this and my duke for being a fool. I run away with my siblings as disowning my very own 'father' as living secretly with my maternal grandfather, Marquess Valencia. While living few years with Grandpa, I meet the Villainess Rosabella Bardales who was in her weakest state and seems that she run away from her neglectful father and her abusive half-brothers. I felt sympathy for her, and I took her in by knowing her painful past. Seriously, why tragic people like her, and my siblings are always suffering by the same nonsense of our so called 'Families'? Even knowing why OG Elisha was chosen as the Male Lead's dad concubine. "Elisha, no matter what happens, I promised to be by your side...even if the world, calls you a witch or monster" I look back and seeing the Dragon Lord who looks at me gently and showing me some comfort. I smile before I look at him with pink dusts on my pale face. "Thanks, Draco. For being by my side, I appreciate it from the bottom of my heart". We shall find our happiness and have own Happy Ending.
Reborn again to change WHAT? by PH2scenario
32 parts Complete
It was Edith's third life. First she was a poor hardworking girl lost under the pressure of work in the modern world of airplanes and computers but then she died.... Then she found herself in the novel she used to read. The book was worn out as she had reread it several times and now she is bound to the plot as a character who had to avoid the fate of ending up the villainess's accomplice and save her life. So her choices ultimately almost led to a happy ending where she even fell for one of the second male leads but then...SHE DIED AGAIN. ＞﹏＜ ＞﹏＜ ⏳⏳⏳ Now again she was in the novel world. Was this to avoid death or her lover? She couldn't really say but the only thing was some characters were now different from the initial novel plot especially Derek whom she loved. Now she wasn't even sure if it was really the actual Derek or someone else. So was she brought back again to find the real Derek? (Story is mine. Do not copy.)
The Unpredictable Villainess by CasildaJosse
42 parts Ongoing Mature
Mellisa Marie is a decent stressed workaholic officer. On her way home, she faces a traumatic accident which leads her into a novel she used to read on her weekends. As a reincarnated Villainess, Mellisa faces a huge pressure. She's married to Emperor who is no one but Lorenzo Morelli, a tyrant. How long can Mellisa survive as ARMANA FRAULEINS ?
The Land of Suna: Queen of Lavender Vol 1-2 (T.C.P. Series) by M1SSSTARLIGHT
11 parts Ongoing Mature
Introduction: Silvana has been cursed to reincarnate over and over again. Several lifetimes have been lived. She tried her best every single time. But it's never enough to get peace whenever she dies. Now, she's forced to rule over an entire desert kingdom in order to appease the gods once again. Here's hoping this is the last time. (Created in March of 2024) (I don't own any art.)
You may also like
Slide 1 of 10
I Must Save the Evil King cover
Unraveling The Misconceptions cover
Reincarnated in a Fantasy World cover
The Odd Return cover
The Villainess Will Not Bring Dishonor To Her Family cover
The Inured Villainess cover
We shall find our own Happy Ending cover
Reborn again to change WHAT? cover
The Unpredictable Villainess cover
The Land of Suna: Queen of Lavender Vol 1-2 (T.C.P. Series) cover

I Must Save the Evil King

41 parts Complete

I'm trapped in the world of my favorite novel. Elizabeth has never had the best life but now that doesn't matter. Now she is living as Claudette, a character from her favorite novel. The only thing Claudette is destined to die at the hands of the Evil King who Elizabeth has a massive crush on. Can she come to her senses and run away or will she try and save the Evil King? Updates Weekly

More details