Story cover for The General's Second Life as a Lady (Discontinued) by VeronicaRodrigue4845
The General's Second Life as a Lady (Discontinued)
VeronicaRodrigue4845
  • WpView
    Reads 143
  • WpVote
    Votes 0
  • WpPart
    Parts 2
  • WpHistory
    Time 5m
  • WpView
    Reads 143
  • WpVote
    Votes 0
  • WpPart
    Parts 2
  • WpHistory
    Time 5m
VeronicaRodrigue4845
Complete, First published Oct 14, 2021
-romancearistocracydukeempireenglishfantasyfantasy-romancefemaleprotagonistlovemarriagenobilitynoblenobleladynoblemanreincarnatedreincarnationromance
Azalea, a general of the Kingdom of Vitalis, meets her untimely end amidst a battle in the war against the Edessa Empire. Death, however, is not the end of Azalea's story; she reawakens one year after her death, in the body of a duke's wife who also happens to be the daughter of a count. How will she navigate her new life as a noblewoman?

(Disclaimer: The cover image is NOT mine. Credit goes to @irt_5433 on Twitter)
Public Domain
-romancearistocracydukeempireenglishfantasyfantasy-romancefemaleprotagonistlovemarriagenobilitynoblenobleladynoblemanreincarnatedreincarnationromance
Table of contents

2 parts

Sign up to add The General's Second Life as a Lady (Discontinued) to your library and receive updates
or
#780aristocracy
Content Guidelines
You may also like
The Inured Villainess by emwritesbookstories
47 parts Complete Mature
Inure: (v.) To accustom to accept something undesirable, evil, or painful. An other worldly girl is reincarnated as Queen Estella de Royalis, the villainess of a novel that is killed by her own husband. Having no other choice, she strives to save herself from that fate. However, the novel she read is not the reality she believed. ______ I tried on another, a red one this time. I twirl in its large skirt. "This one matches your eyes," I say as I spin. "This one too." I stop, putting my hands on my hips. "Are you going to order all of them?" "If I want to, yes, I will." He doesn't budge. I sigh, sitting next to him. "You know that you don't have to do this. I can go buy my own dresses." "I know, but I want to see you wear dresses that I chose. Besides, is it so wrong to want to spend time with you?" ______ Note: This is entirely my work. I want to see if I'm able to write something without a plot set up for me. I hope you like it!
The Odd Return by Allison028
35 parts Ongoing Mature
The story of a reincarnated villainess. "It's your life now." Sometimes we find peace in our constant suffering, sometimes we break free of our suffering, but sometimes, we escape to a foreign land were, where newfound family becomes our own. Then we call that place home. Evanora Esmeray. A talented magician. Under her cold persona and her image as the aristocrat society leader, and a villainess, she hides the warmth she has for her family and friends. It's not surprise that she couldn't leave a man dying in the forest, but did she know what trouble she was getting into? Of course not. Crown prince Lucian De Conlaed Alastair. As majestic as a royal can be. Even after spending years in the battlefield nothing was able to remove his glamor. He was indeed a blessing from the gods. But sometimes this blessing is also found under trees of forests. Often drunk. And sometimes stabbed. Either works for him. And two people who were bound to never collide, crashed into each other. And oh, how fate turns the strings. #Highest rankings : 1 in magicalcreature out of 13.3K 1 in court out of 4.8K 4 in count out of 1.46K The Odd Return Started: 16/05/2023 Ended: I try to upload once a week!
From Dawn, To Dusk - With Love by TheSpearOfLight
23 parts Complete Mature
Azalea lives in a world where dragons are real. However people who have the ability to change into dragons or better known as 'people of dragon-blood' are hated by society and condemned to work as servants with little to no wages. Azalea being one of these servants. What Azalea thought was a normal day turns to be the opposite when she finds a letter addressed to her pen name 'Dawn'. Curious, Azalea writes back and thus she begins a wonderful relationship with a man only known to her as 'Dusk'. Content to deny him of her heritage she never informs him of who she is and hopes their relationship stays as just pen-pals. But when was anything ever so simple... ___________________________________________________________________________________ As the two of them pulled apart Azalea felt her cheeks flare and her the corners of her mouth pull up in a stupid grin. "I- have to go I'll uhm see you later your majesty." she said about to pull away but Thrasher's arms trapped her in place as she felt him kiss her again and again. The feeling so wonderful she couldn't stop even if she wanted to.
The Cursed Witch by nimnken
20 parts Complete
Reincarnating, dying, repeat. My life revolves around those three. This has been going on for so long that my memory of my first life already became hazy. And right now, I was reincarnated in a novel I read from my previous life. A novel where the second male lead was being taken advantage of by the heroine but was just discarded in the end. And I would prevent that from happening to him #1- Fantasy-romance (08/27/23) #11- Fantasy (10/23/23) #35- Fantasy (08/02/23) #32- Aristocracy (08/13/23) #24- Otherworld (08/17/23) #39- Otherworld (08/13/23) ⚠️ UNDER CONSTRUCTION ⚠️
We shall find our own Happy Ending by amey78
35 parts Ongoing
'Are you kidding me' That's what I thought as I find out I got reincarnated into so called Romantic Fantasy novel I read which of all the people I could've lived a normal life, I got reincarnated as Elisha Elizondo, a tragic character who dies by the hands of Male Lead's perverted dad after her own father force her became his concubine? Even my own siblings who died and have a horrible fate that ended with death and suicide? Oh, dear God. I'm flipping this forsaking plot. Screw this and my duke for being a fool. I run away with my siblings as disowning my very own 'father' as living secretly with my maternal grandfather, Marquess Valencia. While living few years with Grandpa, I meet the Villainess Rosabella Bardales who was in her weakest state and seems that she run away from her neglectful father and her abusive half-brothers. I felt sympathy for her, and I took her in by knowing her painful past. Seriously, why tragic people like her, and my siblings are always suffering by the same nonsense of our so called 'Families'? Even knowing why OG Elisha was chosen as the Male Lead's dad concubine. "Elisha, no matter what happens, I promised to be by your side...even if the world, calls you a witch or monster" I look back and seeing the Dragon Lord who looks at me gently and showing me some comfort. I smile before I look at him with pink dusts on my pale face. "Thanks, Draco. For being by my side, I appreciate it from the bottom of my heart". We shall find our happiness and have own Happy Ending.
𝖀𝖓𝖗𝖆𝖛𝖊𝖑𝖎𝖓𝖌 𝕿𝖍𝖊 𝕸𝖎𝖘𝖈𝖔𝖓𝖈𝖊𝖕𝖙𝖎𝖔𝖓𝖘 [Editing] by tanviwrts
31 parts Ongoing
ᴠɪᴏʟᴇᴛ's ᴇxᴘᴇᴄᴛᴀᴛɪᴏɴ ᴏғ ʜᴀᴠɪɴɢ ᴀ ᴘᴇᴀᴄᴇғᴜʟ ᴅᴇᴀᴛʜ ɢᴇᴛs ᴄʀᴀsʜᴇᴅ ᴡʜᴇɴ sʜᴇ ᴜɴᴇxᴘᴇᴄᴛᴇᴅʟʏ ʀᴇɪɴᴄᴀʀɴᴀᴛᴇᴅ ɪɴ ᴀ ɴᴏᴠᴇʟ sʜᴇ ᴡᴀs ʀᴇᴀᴅɪɴɢ ʙᴇғᴏʀᴇ ɢᴇᴛᴛɪɴɢ ᴄʀᴀsʜᴇᴅ ʙʏ ᴀ ᴄᴀʀ. ᴛʜᴇ ᴘʀᴏʙʟᴇᴍ ᴡᴀs sʜᴇ ᴡᴀs ɴᴏᴛ ʀᴇɪɴᴄᴀʀɴᴀᴛᴇᴅ ᴀs ᴛʜᴇ ʜᴇʀᴏɪɴᴇ, ᴏʀ ᴛʜᴇ sɪᴅᴇ ᴄʜᴀʀᴀᴄᴛᴇʀ. sʜᴇ ᴡᴀs ʀᴇɪɴᴄᴀʀɴᴀᴛᴇᴅ ᴀs ᴛʜᴇ ғᴜᴄᴋɪɴɢ ᴠɪʟʟᴀɪɴᴇss!! ᴏғ ᴛʜᴇ ɴᴏᴠᴇʟ ᴀɴᴅ ɢᴇᴛs ᴋɪʟʟᴇᴅ ʙʏ ᴛʜᴇ ᴅᴇᴍᴏɴ ᴋɪɴɢ ғᴏʀ ʜᴜʀᴛɪɴɢ ᴛʜᴇ ʜᴇʀᴏɪɴᴇ. 𝒲𝒽𝒶𝓉 𝓌𝒾𝓁𝓁 𝓈𝒽ℯ 𝒹ℴ? 𝒽ℴ𝓌 𝒾𝓈 𝓈𝒽ℯ 𝑔ℴ𝓃𝓃𝒶 𝓈𝓊𝓇𝓋𝒾𝓋ℯ 𝒾𝓃 𝓉𝒽ℯ 𝓃ℴ𝓋ℯ𝓁 𝒶𝓃𝒹 𝒶𝓋ℴ𝒾𝒹 𝒽ℯ𝓇 𝓉𝓇𝒶𝑔𝒾𝒸 𝒹ℯ𝒶𝓉𝒽? ______________________________________________________ 𝓣𝓱𝓲𝓼 𝓲𝓼 𝓶𝔂 𝓯𝓲𝓻𝓼𝓽 𝓼𝓽𝓸𝓻𝔂. 𝓼𝓸 𝓹𝓵𝓮𝓪𝓼𝓮 𝓮𝓷𝓳𝓸𝔂.
I Must Save the Evil King by Partially_Sunny
41 parts Complete
I'm trapped in the world of my favorite novel. Elizabeth has never had the best life but now that doesn't matter. Now she is living as Claudette, a character from her favorite novel. The only thing Claudette is destined to die at the hands of the Evil King who Elizabeth has a massive crush on. Can she come to her senses and run away or will she try and save the Evil King? Book 1 of 2
Althea by estxlliaa
45 parts Complete Mature
"My sword is one inch away from slicing your neck. My victory is one inch away, yet why can't I do it, Althea? What kind of spell have you cast on me to have me thinking about you all day?!" ----------- Byeol meets a tragic death at age nineteen, but instead of passing on to the afterlife, she finds herself reincarnated into a novel she read in her past life. Now living as Althea Asten, the villainess, who is also bound to lose her life at age nineteen, she realizes that if she doesn't do something to change her future, she will die at a young age in this life too! Now fully motivated and confident, she is ready to rewrite this story until she can escape this empire. Aias Solace. The male lead in the original novel is ruthless and cold at heart. There's one person he hates more than his emperor father, Althea Asten. She who has been blessed by the goddess, is seen as a threat to the throne by him. He shall do anything in his power to make sure Althea falls from her power, taking the temple down with her. His plan is perfect - all he has to do is execute it. What happens, though, when he realizes Althea is acting... strange? Like she's not exactly... Althea. - First book in the echoes of life and death series - [A/N] All art belongs to their respective owners. None of the art (in the cover, in the headers etc) is mine, only the storyline. -Detailed murder scenes -mature language
The Art Of Getting Rich Again by Vissius
5 parts Ongoing
She had it all-money, power, luxury. A brilliant businesswoman at the peak of success, she lived in a world where intelligence and cunning ruled. But in the blink of an eye, everything was taken from her. Struck by lightning and thrown into an unfamiliar medieval fantasy world, she wakes up with nothing. No wealth, no connections, no mana-not even a noble title. Just a sharp mind, a relentless drive, and a burning desire to reclaim the status she once had. In this new world where power is determined by bloodline, magic, and strength, she must outwit corrupt nobles, manipulate guilds, negotiate with criminals, and navigate a world filled with hidden dangers. Along the way, she gathers a small but loyal group of allies-a cold-hearted fallen noble, a thick-headed warrior, a skeptical scholar, and a seductive spy. With no magic of her own, she must use business, strategy, and deception to rise above the system. The world is against her, but she doesn't care. Because in the end, wealth isn't about magic or bloodline. It's about who plays the game better. And she intends to win.
The Land of Suna: Queen of Lavender Vol 1-2 (T.C.P. Series) by M1SSSTARLIGHT
14 parts Ongoing Mature
Introduction: Silvana has been cursed to reincarnate over and over again. Several lifetimes have been lived. She tried her best every single time. But it's never enough to get peace whenever she dies. Now, she's forced to rule over an entire desert kingdom in order to appease the gods once again. Here's hoping this is the last time. (Created in March of 2024) (I don't own any art.)
You may also like
Slide 1 of 10
The Inured Villainess cover
The Odd Return cover
From Dawn, To Dusk - With Love cover
The Cursed Witch cover
We shall find our own Happy Ending cover
𝖀𝖓𝖗𝖆𝖛𝖊𝖑𝖎𝖓𝖌 𝕿𝖍𝖊 𝕸𝖎𝖘𝖈𝖔𝖓𝖈𝖊𝖕𝖙𝖎𝖔𝖓𝖘 [Editing] cover
I Must Save the Evil King cover
Althea cover
The Art Of Getting Rich Again cover
The Land of Suna: Queen of Lavender Vol 1-2 (T.C.P. Series) cover

The Inured Villainess

47 parts Complete Mature

Inure: (v.) To accustom to accept something undesirable, evil, or painful. An other worldly girl is reincarnated as Queen Estella de Royalis, the villainess of a novel that is killed by her own husband. Having no other choice, she strives to save herself from that fate. However, the novel she read is not the reality she believed. ______ I tried on another, a red one this time. I twirl in its large skirt. "This one matches your eyes," I say as I spin. "This one too." I stop, putting my hands on my hips. "Are you going to order all of them?" "If I want to, yes, I will." He doesn't budge. I sigh, sitting next to him. "You know that you don't have to do this. I can go buy my own dresses." "I know, but I want to see you wear dresses that I chose. Besides, is it so wrong to want to spend time with you?" ______ Note: This is entirely my work. I want to see if I'm able to write something without a plot set up for me. I hope you like it!

More details