Story cover for Serial Lovers by jnoelpublishing
Serial Lovers
jnoelpublishing
  • WpView
    Reads 1,262
  • WpVote
    Votes 29
  • WpPart
    Parts 17
  • WpHistory
    Time 3h 23m
  • WpView
    Reads 1,262
  • WpVote
    Votes 29
  • WpPart
    Parts 17
  • WpHistory
    Time 3h 23m
jnoelpublishing
Ongoing, First published Oct 25, 2021
Mature
bloodchapterdramajanaejanaejohnsonkillkillerlustmagnusnewadultnewyorknoahnoahvasarioriginaloriginalstoryparanormalromanceseriessmutwarningsteamythrillervampirevampireromancevictoriayoungadult
Janae Johnson moves from her home in San Diego, California to the grand city of New York to attend NYU. She goes out for some last minute shopping, when she meets him; a tall mysterious stranger with tattoos and a jaw that could cut bread. Every one of her instincts says to stay away from him, but she can't seem to listen. Despite the fact that he is a walking red flag, she falls for him. When she uncovers that he's been keeping a deadly secret will she still love him?

Noah Vasari has been back in New York for twenty years, keeping his secret hidden from the world. Here it is much easier to do what is necessary for him to survive, a few lives here and there went unnoticed when the population is 8.8 million. One day he met her; a stunning, fiery stranger with beautiful blond hair. He was captured immediately. He hadn't loved in years, could he love again? He does what he can to keep his secret from her, but when she discovers it, can he allow her to live with that knowledge?
All Rights Reserved
bloodchapterdramajanaejanaejohnsonkillkillerlustmagnusnewadultnewyorknoahnoahvasarioriginaloriginalstoryparanormalromanceseriessmutwarningsteamythrillervampirevampireromancevictoriayoungadult
Table of contents

17 parts

Sign up to add Serial Lovers to your library and receive updates
or
Content Guidelines
You may also like
Frozen Tears by SophiaKjeldbjerg
41 parts Complete
COMPLETED. "What are you?" he asks, his deep melodious voice vibrating in my ears. I refuse to show him any weakness, any fear at all. I stare into those endless eyes. "I don't know..." my body is covered in shivers when he lights up in rage and punches the brick wall behind me, creating a perfect dented hole, as if the wall was made of plaster. "Don't test me, princess," he hisses, bending further in towards me. "You have no idea what I could do to you." he licks his lips, and I have just enough time to catch a glimpse of pointy teeth before a raging pain slices through my neck. ............... Emma Sanders is a seventeen-year-old girl, moving to a foreign town, one of those that you wouldn't find on a map, except maybe if you measured it by inches. But a secretive group of blood, fangs, and mystery has her attention, and it would destroy anything in its path to figure out what she really is. ............... Copyright 2014 - Sophia Kjeldbjerg No part of this story may be copied, reproduced, stored in a retrieval system or transmitted to anyone. It cannot be transmitted or copied by any means - such as by electronic devices, photocopies, recordings, mechanics or any other forms - without prior written permission from the author. Copying this story is a violation of the copyright law.
My Somatic Vamp |Jenlisa G!P by McStudios_com
28 parts Complete Mature
Lisa was known to be 18, while Jennie was 17. They weren't from the same high school, but they happened to at a club the in the middle of the night. They introduced each other and Lisa was fell in love with Jennie that they hit it off together as friends soon to be more, yet during an intercourse together on Jennie's 18th birthday. She screams to what Lisa was doing. Turns out Lisa wasn't normal and was scared for Jennie to get old and die like a human being. Afraid that her lover Jennie Kim would leave her. So she bites Jennie's neck when making love, her fangs that feel her struggle then she passes out. She knew it was selfish of what she did, but what happened next was unexpected for Lisa. Jennie soon had to transfer to Lisa's private and prestigious high school that was known to be hard to get into filled with many other wealthy students. Jennie discovered just why it was hard for students to attend this high school. Jennie hated Lisa for what she did, yet it made no difference to what she discovered about herself. Jennie just had to deal with the new environment that circulated around her and follow strict rules... Even discovering new things that felt familiar... ⚠️ ‼️ WARNING ‼️ ⚠️ This story is for mature audiences, which involves gore, death, sex, language content, Sexual Assault, force, manipulation, dark romance, and Lisa G!P. ⚠️ ‼️ You've been warned‼️ ⚠️ Originally made by me.
Marked By The Tiger by Angela_SK08
9 parts Ongoing Mature
⚠️ Story Warning ⚠️ This Story contains possessive tendencies, death and psychological tension. Read only if you're ready to step into a world where love is twisted, dominance is intoxicating, and your heart may not survive unscathed. THEME:> Mafia's Obsession. GENRE:> Possessive Mafia Romance. SETTING:> California. Russia. TAGS:> Dark Romance, Blood, Mafia Elements, Possessive Love, Obsession, Young adult Romance, Territorial behavior, R rated scenes, and Lots more... DISCLAIMER:>This Is A Work Of Fiction. Any Names, places, Characters, Or Incidents Are Purely A Product Of Imagination. WRITER:>Angela Sk. ≈≈≈≈≈≈≈≈≈≈ INTRODUCTION Ruby Kim doesn't do love. She doesn't do rules, doesn't do attachments-just chaos, danger, and adrenaline. She's the reckless bad girl with a sharp tongue and a past buried in shadows. College is just another playground. And her new housemate? Just another forgettable nerd. At least, that's what she thinks Ivan VK is a ghost in the crowd-quiet, unassuming, untouchable. But beneath the glasses and silence, there's something off. A predator's patience. A darkness too deep to ignore. His watchful molten Orange eyes aren't those of a prey. They belong to a hunter. When Ruby pushes too hard, when she crosses a line she didn't even know existed, she learns the truth: Ivan isn't just dangerous. He's lethal. And for the first time in her life, she might've found someone who can outmatch even her insanity. But when prey dances with a predator... who really gets devoured? Can She outrun fate... when it's wearing molten orange eyes? What happens when chaos meets cold-blooded control? FIND OUT NEXT .... ON MARKED BY THE TIGER. ‼️WARNINGS‼️ ‼️ Bipolar disorder.‼️ ‼️Psychological Problems. ‼️ ‼️Blood and Gore‼️. ‼️Descriptive Killing spree. ‼️ ‼️Dark , Dominant tenders. ‼️ ‼️ Emotional manipulation ‼️ ‼️Read with Caution. Don't judge a book by its
The Vampire and The Ghost | ✔︎ by SammyE9
63 parts Complete
[BOOK ONE OF THE VAMPIRE AND THE GHOST SERIES] She's dead, he's undead. An unusual duo make their way through the modern world, and its modern challenges. Annalise Redwood had spent too much time alone, floating in a centuries old house. The very same house she was murdered in 5 years before. She'd watched people leave, come in, investigate and even squat in this house. Yet none of them stayed long. And more importantly none of them saw her. It was hell, and she swore she was cursed. But this all changes, on the 5th anniversary of her death when a seemingly normal young man walks in. And he sees her. Eugene Cubert was old. Too old. He was done with life, had lived, breathed (well not really) and seen too much for one soul to bare. Quite frankly all he wanted to do was find a nice house to live in and spend the rest of the century comfortably locked away from all of the supernatural and natural. He's visiting his 5th house that day, when he hears it. A woman, screaming to be seen. And then he sees her. And nothings quite the same after that. ---------------------------------------------------- #No.2 in paranormal 3/7/2021 #No.1 in ghost 9/7/2021 #No.8 in murder 2/8/2021 Updates weekly! (unless otherwise said)
The Fourth Horseman by SheRexx
40 parts Complete Mature
I was falling, cascading into the dark chasm of sin and desire. I was unhinged, wild and free, giving in to everything I wanted. I would not hold back tonight. I wanted to fuck him over and over, anywhere and everywhere. Taste him and kiss him. Completely surround myself with only Jay. I will do it all with Jay tonight and every night forward. I am his queen, his weakness, his carnal transgression. I will take him as my own and ride out this delusion with him come what may. A tiny voice in the back of my mind was scolding, cursing, pleading at me to come to my senses, realize the mistakes I was making and the repercussions I would face. I suffocated the whispers, murdered my rational logic in that moment. Death was swift for the girl in my mind looking down with a frown on my actions. I laughed again, knowing this would be my undoing, enjoying the unraveling of my sanity, leaving it in shards on the ground. Because I had made up my mind. I won't let go. ****TRIGGER ⚠️ WARNING This book contains mature content; including language, violence, sexual content, drugs and alcohol and a near rape scenario. There will be no other warning throughout. Thank you for reading!
Chosen by the Vamprie, Book One by AtlasRoseRomance
13 parts Complete Mature
(Completed Book One 🖤) They're sinful. Beautiful. Deadly. And more dangerous than the wolves who hunt us in the woods. Three Vampires rule our world. And now I find myself in their clutches. Abducted in the dead of night, I'm taken to a market where eleven others like me are paraded in front of the Sinful. The Vampires want the perfect companion. The one mortal who'll not only sit beside them on the throne...but who'll occupy their bed. We're to be judged, challenged...and selected one by one to continue the hunt. They'll punish us. They'll seduce us. They'll take us from the light and leave us craving the dark. Only I came with a secret of my own. They are the monsters I hate...the monsters who killed my family eleven long years go. I came for blood. I came for revenge, only as I'm drawn deeper into their deadly game my body starts to betray me. I crave surrender. I lust for them. I need to be the last one selected. Can I go through with my plan? Or will I be claimed by the monsters I despise?
𝗷𝗼𝗶𝗻 𝗺𝗲, 𝟬𝟬𝟭/𝗵𝗲𝗻𝗿𝘆 𝗰𝗿𝗲𝗲𝗹 (✔️) by _behindyou_
12 parts Complete Mature
[COMPLETED] ᴛʜᴇ ꜱᴋʏʟɪɴᴇ ꜰᴀʟʟꜱ ᴀꜱ ɪ ᴛʀʏ ᴛᴏ ᴍᴀᴋᴇ ꜱᴇɴꜱᴇ ᴏꜰ ɪᴛ ᴀʟʟ ɪ ᴛʜᴏᴜɢʜᴛ ɪ'ᴅ ᴜɴᴄᴏᴠᴇʀᴇᴅ ʏᴏᴜʀ ꜱᴇᴄʀᴇᴛꜱ ʙᴜᴛ ᴛᴜʀɴꜱ ᴏᴜᴛ ᴛʜᴇʀᴇ'ꜱ ᴍᴏʀᴇ ʏᴏᴜ ᴀᴅᴏʀᴇᴅ ᴍᴇ ʙᴇꜰᴏʀᴇ ᴏʜ, ᴍʏ ɢᴏᴏᴅ ʟᴏᴏᴋɪɴɢ ʙᴏʏ --------------------------------- she was his light. his happiness, his everything. but then she found out. ➤ slightly yandere?001 x female!reader ➤ disclaimers : - please read all the chapters before the start of the story as they include warnings and such - the art and pictures in this book do not belong to me unless i say they do - may include smut ➤ started ; 7/07/22 finished ; ??? ➤ stranger things does not belong to me, it's rightfully owned by the duffer brothers ➤ highest ranks ; ///// ©_behindyou_/2022
Claiming Violet (an ADULT stalker dark romance) by mrsdarkromance
21 parts Complete Mature
TRIGGER WARNINGS : Cnc, violence, substance abuse, there are scenes of r*pe and degradation. Please read at your own risk. ENJOY! After her parent's tragic death, nineteen year old Violet Sinclaire moves to old mansion left to her by her father in Louisiana. She plans to find herself, restore herself.. be someone new. However, Violet has no idea of the all consuming and all frightening series of events that will unfold. He watches her. She knows it, and she wants to dive in head first. Violet SinClaire I love this house. I love that it's old and that I have good memories here. I came up here every summer with my brother as a child. It's morbid, I will admit, but then again so am I. But something feels different here this time around.. I feel uneasy, the air feels thicker. Something is calling to me.. or someone. Someone is watching me. The thought instills terror in me and sends waves of fear down my spine.. but I want to know more. I need to know more. What do they want? The Watcher I want her. I watch her. I crave her. I want to hurt her. I will have her, it's just a matter of time. Violet SinClaire will be mine, by any means. She will be become undone by my hands. She loves me, she just doesn't know that yet. I'm here to help her see. I will claim her.
The Harmony Effect |Book I| by MaxineScythe
3 parts Complete Mature
"You're shaking. So, how can you say I have no effect on you?" *** Brought up in a life of crime by his Father, 28-year-old Noah Rite dominates the streets of New York as a legendary man who demands control and doesn't settle for failure. Known to all as "The Grim Reaper", and unforgivingly brutal to his enemies, his only savior comes by Bobbi Potter, his best friend and secret captor of his heart and soul whom he'd die to protect. For 26-year-old Bobbi, as someone who's lived in a tough and abandoned world of her own, running into Noah was nothing short of kismet. Trusting her life to the man she's known for nearly 20 years, Bobbi's been by his side through the gates of Hell and back without question. And even when she fell for another named Elijah, the love and admiration for each other never seized. As time passed, Noah finally finds himself ready to leave the world of blood and fear behind for a better life as a boring mechanic, however, after an unexpected discovery reveals the ugly truth about Bobbi's fiancé, Noah's unhinged intentions result in more harm than healing and only a lie can pick up the shattered pieces - Catapulting him back into the everlasting throes of chaos for an unforeseen time. One year later, and with Bobbi deep in Noah's domain of infamy, the chance to escape the struggles of a deadly future reveals itself once more when demons and other closeted skeletons resurface and begin to manifest in unpredictable ways. And like a vicious cycle, their friendship will be forced to withstand the disarray of backstabbing past mistakes while exploring the depths of their soulful bond. But with Noah blinded by his festering desires, only carnage and bloodshed will follow his refusal to let them crumble. All in the name of love? So be it. © 2019-2025 Maxine Scythe
WARZONE by JessMajestic
69 parts Ongoing Mature
(18+ EXTREMELY MATURE CONTENT) ***this book contains vulgar language, violence, obsessive behaviour, mental disorders and other content that may be very sensitive to some readers**** ----READ AT OWN RISK---- Sin ' Devil ' Grey, a killing machine, merciless, a psychopath are all the words they call him. A monster that enjoys watching people suffer. The ring was his escape, where he went to run away from his demon's and haunting past. But its only for so long that he can run away from himself...... Luna Winters a stubborn girl who has a dark past that turned her into what she is, she has walls built very high that no one's ever dared to break. What happens when she finds herself having to pay a debt that's not even hers but will cost her her life. What happens when these two collide in the most scandalous way ever and she uncovers dark and terrifying secrets that tell her exactly why they called him "Devil". Find out what happens when the she two paths collide in a very dangerous world of blood, pain and sorrow. in a WARZONE _______________________ Highest rankings: #7 sexy #4 desire #6 lust #99 love #8 mafia #16 lover
You may also like
Slide 1 of 10
Frozen Tears cover
My Somatic Vamp |Jenlisa G!P cover
Marked By The Tiger cover
The Vampire and The Ghost | ✔︎ cover
The Fourth Horseman cover
Chosen by the Vamprie, Book One cover
𝗷𝗼𝗶𝗻 𝗺𝗲, 𝟬𝟬𝟭/𝗵𝗲𝗻𝗿𝘆 𝗰𝗿𝗲𝗲𝗹 (✔️) cover
Claiming Violet (an ADULT stalker dark romance) cover
The Harmony Effect |Book I| cover
WARZONE cover

Frozen Tears

41 parts Complete

COMPLETED. "What are you?" he asks, his deep melodious voice vibrating in my ears. I refuse to show him any weakness, any fear at all. I stare into those endless eyes. "I don't know..." my body is covered in shivers when he lights up in rage and punches the brick wall behind me, creating a perfect dented hole, as if the wall was made of plaster. "Don't test me, princess," he hisses, bending further in towards me. "You have no idea what I could do to you." he licks his lips, and I have just enough time to catch a glimpse of pointy teeth before a raging pain slices through my neck. ............... Emma Sanders is a seventeen-year-old girl, moving to a foreign town, one of those that you wouldn't find on a map, except maybe if you measured it by inches. But a secretive group of blood, fangs, and mystery has her attention, and it would destroy anything in its path to figure out what she really is. ............... Copyright 2014 - Sophia Kjeldbjerg No part of this story may be copied, reproduced, stored in a retrieval system or transmitted to anyone. It cannot be transmitted or copied by any means - such as by electronic devices, photocopies, recordings, mechanics or any other forms - without prior written permission from the author. Copying this story is a violation of the copyright law.

More details