The Wood Elf
AdamTheberge
  • Reads 45
  • Votes 2
  • Parts 11
  • Time 2h 18m
  • Reads 45
  • Votes 2
  • Parts 11
  • Time 2h 18m
AdamTheberge
Ongoing, First published Nov 12, 2021
battleelvesfantasymagicspellswar
As the wood elves prepare for the moon festival and the arrival of the moon elves, they are attacked by an evil force bent on destroying them and taking their mystic tree.

Olin is an energetic and overly positive young elf on his way to full Scout status when the war breaks.  His very nature will be tested in the face of much destruction and death.
All Rights Reserved
battleelvesfantasymagicspellswar
Table of contents

11 parts

Sign up to add The Wood Elf to your library and receive updates
or
Content Guidelines
You may also like
Star Wars: Episode VII: The Last Jedi(My version) by DjMandalore141
32 parts Complete Mature
Since the war between the First Order and the Galactic Alliance started the galaxy is experiencing a massive shift with the powerful entity Abeloth still on the lose causing mayhem and chaos wherever she goes. The Daughter and The Son, using their god-like powers to bring back anyone they deem powerful and strong enough to battle this great cosmic force as well as each other. Meanwhile as the war rages onward the Force-Sensitive Rey trains on D'qar with a legendary Jedi Master to become ready to fight against both the First Order and the New Sith Empire.
Shadow of Light (Uruk-Hai x She-Elf) by ObsurdNerd
84 parts Ongoing
As the war rumbles, on elf lives unawares from the safety of her forest, until the war comes to meet her on her land, bringing more than she could ever have expected. (Based on Peter Jackson's Lord of the Rings, and the original books) Warnings: Mildly graphic battle sequence and moderately sexual tones.
The Adventures of a Sword by Looperreallysucks
30 parts Complete Mature
A group of teenagers embark on a quest to end the tyrannical rule of an evil emperor.
The Elf Thief by singtherage
55 parts Complete
When a king lost the one thing he ever loved, he turned to the only thing he thought could comfort him: revenge. He made it his purpose in life to kill all of the nations of magical creatures, to avenge one life with a thousand. But the elves banded together and fought back, creating the Elf Thieves. When secrets are revealed and everything changes in a way fate itself could not have foreseen, two born enemies must put aside their differences and become the heroes that their land needs.
The Return Of Shadows by Sarah35487
14 parts Complete Mature
Elora starts having nightmares of The Dark Lord. She's now having her first child while a new threat is rising and Middle Earth is once again dragged into a war against Sauron and his orcs. But he's not the only threat. Will Elora with her family be able to defeat the new threat or is she Middle Earth's doom to endless darkness? [Book 3 of The Princess Of Mirkwood series]
(PTII)Defenders of Middle Earth: A Middle Earth Story(Book 4) by GerithorDunedain
46 parts Complete
With Sauron's advance in the West temporarily halted, the Lastborn and his companions travel East over the Misty Mountains to aid the dwarves of Erebor. But more than just orcs and Easterlings await them there. One of Sauron's most powerful servants, a Black Numenorean sorceress known only as The Lady of the Dead Tree, seeks to stop the Ranger's passage... At all costs. Join Gerithor, Glorfindel, and many other valiant warriors of Middle Earth as they seek to defend all that is good from falling into eternal darkness.
Legend of Fire by Spikenovared
34 parts Complete
Five heroes fight back against a powerful force, out for the world.
THE DRAGONBORN by anxiety__scary
6 parts Ongoing Mature
Long ago dragons ruled the land of Skyrim, creating their dominance for thousands of years on Skyrim but after the great war of Dragonborns and the dragons, they got extinct. Now they were considered as fairly tale but now somehow they all started appearing again, creating chaos and violence all over the Skyrim. In the midst of this Cuschair, son of farmer stood up and takes the responsibility of saving his country as he founds out that he is the chosen one.
The Heart & The Heir by CJPattersonWrites
10 parts Complete Mature
The kingdom of Elves is on the cusp of war. The ruthless Scillari commander will stop at nothing from taking the throne. One boy is simply trying to survive and remain under the radar, when he crosses path with the alluring and irritating Rhycilla. Azkin's fate is soon entwined with hers. With the constant threat of the army hunting them, the pair unknowingly set out to right a wrong that's been centuries in the making.
The New God's Of Avaricia by Musal0_0l
12 parts Complete Mature
SYNOPSIS "To take a place amongst the God's you must take the head of a current God." As the world's end beckons for all on the continent of Avaricia. One boy, a demi-god who up until this point had led a pitiful life rallies a final charge against the heavens. Aided by other demi-gods and powers from the realms he sets about the world's final defence with an impossible plan. A plan that will not only save the four realms but secure their futures too. How? By removing the current Gods from their posts and installing a new hierarchy at the highest of heights ofcourse. Though, that's easier said than done... "If the Gods have abandoned the realms, then maybe it's time for a change in management." Out with the old and in with the new. The new... 'Gods of Avaricia.'
You may also like
Slide 1 of 10
Star Wars: Episode VII: The Last Jedi(My version) cover
Shadow of Light (Uruk-Hai x She-Elf) cover
The Adventures of a Sword cover
The Elf Thief cover
The Return Of Shadows cover
(PTII)Defenders of Middle Earth: A Middle Earth Story(Book 4) cover
Legend of Fire cover
THE DRAGONBORN cover
The Heart & The Heir cover
The New God's Of Avaricia cover

Star Wars: Episode VII: The Last Jedi(My version)

32 parts Complete Mature

Since the war between the First Order and the Galactic Alliance started the galaxy is experiencing a massive shift with the powerful entity Abeloth still on the lose causing mayhem and chaos wherever she goes. The Daughter and The Son, using their god-like powers to bring back anyone they deem powerful and strong enough to battle this great cosmic force as well as each other. Meanwhile as the war rages onward the Force-Sensitive Rey trains on D'qar with a legendary Jedi Master to become ready to fight against both the First Order and the New Sith Empire.

More details