Destined: A Krish/Rajni (Krijni) FF
Annwrites92
  • Reads 1,906
  • Votes 203
  • Parts 28
  • Time 7h 29m
  • Reads 1,906
  • Votes 203
  • Parts 28
  • Time 7h 29m
Annwrites92
Ongoing, First published Nov 17, 2021
bhbkbyahbyahhamaraibahukabyahhamaribahookagauravkhannagreyfemaleindiantvkrijnikrishvaishnavloveloveatfirstsightrajnibalavaishnavrevengeromanceshrenuparikh
Krish didn't believe in love until he meets Rajni, and falls head over heels for her. Rajni agrees to marry him and eventually reciprocates his love. But the stars had something else in mind, and due to circumstances out of their hands, they have to separate. 
Sounds typical? I thought so too. But their story was anything typical. 

For which husband marries his wife, who he loves endlessly, to another man? And which wife, who claims to love him in equal measure, betrays and destroys him?
Is everything forgiven in love and war? Are there any limits to a love that is destined by the divine itself?
All Rights Reserved
bhbkbyahbyahhamaraibahukabyahhamaribahookagauravkhannagreyfemaleindiantvkrijnikrishvaishnavloveloveatfirstsightrajnibalavaishnavrevengeromanceshrenuparikh
Table of contents

28 parts

Sign up to add Destined: A Krish/Rajni (Krijni) FF to your library and receive updates
or
#22shrenuparikh
Content Guidelines
You may also like
MANAN FF : MYSTERY BEHIND REVENGE by santhiyasuresh
24 parts Complete
Hi my lovely readers and friends...This story is gonna be the new experience to me as it is the first time I m gonna write something based in revenge come love... Trust me, u r gonna love it... He loves her, but he can't admit it.. She was being punished for the deed which she never did ... He hate her now for wat she has done with his friend come brother.. But did she done anything! no one knows... He wanted to take a revenge for his brother death .... Is he right on pointing her? Many unfold stories behind this revenge... Will he able to unfold all the mystery behind the revenge... ? Will his love for her overpower his revenge.. ? Will manan be one? Stay tuned and support me in this journey of revenge to immense love... u will definitely love it.. Get into the Train of manan and enjoy this journey... Love Santhiya Suresh❤
The Melody Of Our Love by myinsanemind786
57 parts Complete Mature
Book 1 OF "ISHKAA"SERIES.{18+ ⚠️Warning - Mature content } "Please,please don't hurt me.i don't want to die.i m pregnant.i want to live happily,please don't kill me ."she was repeating these lines again and again to the man who was standing infront of her with black mask on his face and sharp knife in his hand . That man shook his head and came closer to her.she took her steps backwards and suddenly her foot slipped from there and she fell from the 5 floor of the mansion and fell over the car . With this move ,her phone fell from her hand and the screaming sound could heard from the phone. She started closing her eyes.Blood was coming from her body as she was fell from the 5th floor that to on the car's hood with great impact. Before closing her eyes she whispered under her breath"karan" ----------------------------------------- HIS CHUHIA,HER KHADOOS. Check out the journey of love,betrayal and revenge. Tropes~ •slight dark •strong language •smut warning •grumpy×sunshine •Suicide •Obsession •Manipulative •punjabi romance •Adult Romance •College love -----------------------------------------
Deal or चाह ? by Adobe_wrt
16 parts Ongoing Mature
Deal or चाह? CEO × Model Sunshine + Super couple Revenge - Drama - Romance Swati Khanna, a supermodel back in 2019, had everything in her embrace: love, fame, wealth, and a successful career. She achieved all this through three years of struggle and hard work in modeling. However, everything changed one night when her boyfriend asked her to leave modeling. Without any question or doubt, she left her dream for her love. Later, on the night before her wedding, she realized that her boyfriend had stopped loving her long ago. He had been playing with her emotions and using her talents for his business. She discovered him cheating on her with her colleague, Keeya. Heartbroken and betrayed, she married a stranger she didn't even know, except for his fame in the industry, Agastya Vasani. He was a man of every girl's dream who married a model to get rid of family pressure to marry soon because of his age. Tying the knot with a stranger, they decided to give each other a chance, to open up, and to fall deeply in love. But they never found peace in their lives. Even though marrying the wealthiest man in the industry didn't make Swati's life simple and cool, it became more tense. While fighting for her rights and claiming she deserved a chance, she lost many dear ones and met many new loved ones. Despite having a normal life as husband and wife, Agastya and Swati never found that feeling of peace. Will they be able to get the life they wished and dreamed about? In an era of hate and trolling, will they make it?
Loving HIM Unconditionally by Viwataxx
82 parts Complete Mature
FIRST STORY IN THE RAJVANSH SERIES Devendra X Devyani "मोहब्बत इस दुनिया की सबसे खूबसूरत चीज है। जो हमें उनसे हो गई है। अब या तो मेरी मोहब्बत उनके साथ मुकम्मल होगी या फिर उनके प्यार में फनाह होगी"। ________________________________ This is a story of two individuals bound in a sacred union that ties two people together called "Marriage" Join the journey of Devyani Rajput, who entered in the world of Devendra Singh Ranjvansh and made him HER'S. She collected the broken pieces of his heart and made his heart beat again. **** TROPES: • Royal Romance • Arrange marriage • She fell first, but he fell harder • Grumpy x Sunshine • Suspense, past! This story contains mature scenes!
BEAUTY AND THE BEAST by Laziest_Writer
54 parts Ongoing
He was a very cruel man before he met her. The ruthless, the devil, etc were his other names. But he was not like this in his past. His fate made him a heartless person. He was a very kind-hearted person in his past life. An incident changed his life. One day, he accidentally met his lady love. Firstly, they were enemies of each other. She learnt that he had a soft and beautiful heart. She decided to make him joyful as he was in his past. And she succeeds in her plan. He started to enjoy his life again. He smiled after a long time, just because of her. His hate turned into an immense love for her. But his destiny didn't like his happiness. His stars again played a dirty game with him. He searched her everywhere but he didn't find her. He was completely devasted. Will he find her? Will this beast get his beauty, his love again? Just peep into this to know more.
𝐈 𝐃𝐎𝐍'𝐓 𝐁𝐄𝐋𝐈𝐄𝐕𝐄 𝐈𝐍 𝐏𝐄𝐑𝐅𝐄𝐂𝐓𝐈𝐎𝐍𝐒 ! (#3) by writingsbyrayy
54 parts Complete Mature
Vansh and Roshni are college friends. Vansh was a business man who had a bad childhood with his parents having a unhealthy relationship which made him not believe into marriage or love. Roshni was a fashion designer and a girl full of life but unlucky in relationship which didn't really bother her too much. When her best friend Aadhya got married, her mom started pressurizing her for marriage so she came up with a plan to escape this pressure. She decided to fake date with Vansh because he was the only guy from the group who was single. She thought that by doing this her Mom will have a guarantee that she will marry after few time and meanwhile she will come up with an idea to get rid of marriage but the tables are turned. Her mom now pressurize her double than before and now they have to marry each other. Roshni is not really happy about it but Vansh was because he liked her since college days but kept denying it. Both of their lives were never perfect and perfection was almost a myth for them. It's interesting to see how this marriage will turn a myth into a reality and how they fall for each other. Will this marriage be a success or will their marriage fail and break into million pieces? Note: This story contains smut. This story will make more sense if you have read the other two sequence of 'I don't believe' series. If you haven't then no worries it won't be a much problem.
ʟᴏꜱᴛ ᴡɪᴛʜᴏᴜᴛ yᴏᴜ✔[#1 ɪɴ ꜰʀɪᴇɴᴅꜱꜰᴏʀᴇᴠᴇʀ] by bairiya_
28 parts Complete
_COMPLETED_ ***Warning :- My first book and there's a lot of grammatical mistakes so plz...read at your own risk*** Top Rankings #1 in friendsforever #1 in withoutyou #1 in unrequiredlove #1 in lostwithoutyou #1 in ishankishan #4 in wattpadindianawards "HER" She never believed in LOVE. Why? What's the reason behind her hatred towards LOVE? She knows only one thing LOVE is LUST nothing else. She never felt anything for anyone until that for one person who has changed her life but without even knowing. Before, she didn't believe in LOVE. But After, she was the most popular person in her college to know about LOVE. But can anyone define the term LOVE? She is not perfect not everyone is. She don't know if her words are perfect for someone to understand the term LOVE. But she knows one thing for sure, she will find her LOVE soon... Now she believes in LOVE. "HIM" Hot! Rich brat! But not spoilt. Everyone wants a billionaire as her future husband. But he is not only rich but also Down to Earth person. He can't do justice with any other gurls. His best friend is Jayanti, who LOVES him dearly, unconditionally, he did only one mistake, that he didn't saw the love in her eyes. Neither she was going to separate him from his LOVE nor she was going to live this LIFE without HIM. Can leaving the world will help her from this unconditional LOVE to get rid off? She don't know. She don't want to live but leaving is not the best decision. Can LOVING HIM becomes HER biggest mistake? At last he loves her. She loves someone else. And that someone else loves someone else. Complicated? I know. To know this u just need to add this book on ur library and peek into this story to know the journey of one sided LOVE. To know the alone journey of Jayanti. Do justice with me. Please support me. I m a beginner. Thanks for adding this book into ur Library😊👍🙏. Cover credit :- @_starflies_ and @IndianLegion Started:- 02/09/2018 Completed:- 24/10/2019
CHANDRALEKHA - The Beginning Of Destruction ✅ by LostMorpankh
86 parts Complete Mature
BOOK 1 OF 'The WAR of Dynasties' SERIES ✨ Princess Chandralekha was born in a royal family and was promised to the wealthiest king, but little did she know that her would-be husband was a sadist. One by one he tortured and killed all of her family members right in front of her eyes. Dark forces were winning over everyone without anyone's knowledge when 'the saviour' was born in the Sun Dynasty. Read the exceptional journey of Princess Chandralekha. Would she be able to avenge the death of her family? Would 'the saviour' be able to fight these dark forces? •°•°•°•°•°• BLURB Raghav : "LOOK AT HER!" Khyati : "What do you want to show me?" Raghav : "Look at her bosom, and then look at yours. You want me to get lured by it, but for me a woman's breast signifies motherhood. A larger size can carry more milk, which means more nourishment to the child. That's why my mother Kali has huge breasts, because she feeds the entire universe with prosperity, abundance, grains and happiness." "And the womanhood that you are revealing to me, to seduce me, is the golden gate that holds the power to bring life into this world, and you want me to get attracted by it lusciously?" "You know the soul struggles to get a body and only a woman's uterus holds the power to nourish and build a baby's body, nurturing it with her own blood. This core is the passage that all of us have travelled to come into this world, and men ogle it with lewd gaze, huh! Our minds are fucked up, our mindset is ruined, but I am a Goddess worshipper. I worship Her womanhood, and I see her in every woman. No matter how many men have fucked you till now, but I see you as a Goddess. And you are my father's wife, my mother's soul will cry in heaven, if I get seduced by you today."
Bound by Law by CrossAndQuill
60 parts Complete Mature
Highest ranking: #9 Romance & #4 in General Fiction!!! WARNING: I wrote this book when I was 17 so there is a ton of grammatical errors so please read at your own risk! *** Marriage is a sacred union tying two people that love each other, together. It brings happiness and blessings. Or that's what it should be. The marriage between traditional Karishma Varghese and the cold-hearted Jai Agarwal was anything but. Horrible circumstances force these two strangers together. Now bound by law, they struggle with feelings of hate in what they think is a loveless marriage, both holding deep, dark secrets, capable of ruining everything. Those very secrets and differences, however, could be what brings these two together in the end. ❧ "Just because we're legally bound together, doesn't mean I love you." He leaned down, spitting out the next words menacingly. "And I never will." I tried to hold back the tears as his amber eyes blazed with anger. "O-okay." "Now, stay out of my fucking personal life or I won't hesitate to ruin yours." As he left, I broke down. The truth was, I never thought that someone could hate me so much that they'd look at me like they wanted to kill me. Especially not if that someone was supposed to be my husband. ❧ Credit to @IamSumayya for making this absolutely gorgeous cover! Thank you so much for taking your time to make it! ❤️ PS. Highly unedited. Don't read if you're gonna point out every single mistake.
He Felt Like A Storm ||Wattys2018 ||Wattys2019 by AnkSun344
84 parts Complete Mature
The story is of two individuals Siddharth Khanna and Anusha Singh. Both were gems to their parents, both spoiled, both stubborn, friends adored them and siblings love them. Like something very unexpected happens whenever you were least expecting it to be, exactly the same way, the marriage bomb was thrown on to their heads. Their happy days are actually going to die? ~•~ Anusha was a stubborn girl, who thinks she's the queen and her independence means everything to her. She was forced to get married when she turned 25, her marriage was arranged to Siddharth Khanna, the steel industrialist, son of one of her father's friend. A typical Billionaire, she thought. Siddharth Khanna was a successful 27 yrs old man, living his bachelor's life lively. But when it comes to marriage, he rejects every girl his parents select for him, coming up with weird excuses everytime. He thinks no one else deserves his attention, as in no one is better than him. But the day he saw her his life flipped and he fell in love without thinking twice. Usually people fall in love with a smile but he fell for her frown. It doesn't took him long to accept his feelings for her and seconds to confess it to her. One the different side,there was a war going on between her heart and mind, she was confused of her own feelings. She was afraid of his expectations. Everything was going perfect but the only thing pending in their story was her confession. Read the story of their super romantic journey together and fall in Love with them. **Story might contain mild swearing and steamy scenes** Editing in progress ( don't complain about slow) ~Started 14/Dec/2017~ ~Ended 21/Nov/2018~ .Now complete.
You may also like
Slide 1 of 10
MANAN FF : MYSTERY BEHIND REVENGE cover
The Melody Of Our Love cover
Deal or चाह ? cover
Loving HIM Unconditionally cover
BEAUTY AND THE BEAST cover
𝐈 𝐃𝐎𝐍'𝐓 𝐁𝐄𝐋𝐈𝐄𝐕𝐄 𝐈𝐍 𝐏𝐄𝐑𝐅𝐄𝐂𝐓𝐈𝐎𝐍𝐒 ! (#3) cover
ʟᴏꜱᴛ ᴡɪᴛʜᴏᴜᴛ yᴏᴜ✔[#1 ɪɴ ꜰʀɪᴇɴᴅꜱꜰᴏʀᴇᴠᴇʀ] cover
CHANDRALEKHA - The Beginning Of Destruction ✅ cover
Bound by Law cover
He Felt Like A Storm ||Wattys2018 ||Wattys2019 cover

MANAN FF : MYSTERY BEHIND REVENGE

24 parts Complete

Hi my lovely readers and friends...This story is gonna be the new experience to me as it is the first time I m gonna write something based in revenge come love... Trust me, u r gonna love it... He loves her, but he can't admit it.. She was being punished for the deed which she never did ... He hate her now for wat she has done with his friend come brother.. But did she done anything! no one knows... He wanted to take a revenge for his brother death .... Is he right on pointing her? Many unfold stories behind this revenge... Will he able to unfold all the mystery behind the revenge... ? Will his love for her overpower his revenge.. ? Will manan be one? Stay tuned and support me in this journey of revenge to immense love... u will definitely love it.. Get into the Train of manan and enjoy this journey... Love Santhiya Suresh❤

More details