Story cover for Fragrant Peach Blossoms (WENZHOU) (Eng. Ver) {MPREG} by Clarence_writeslol
Fragrant Peach Blossoms (WENZHOU) (Eng. Ver) {MPREG}
Clarence_writeslol
  • Reads 334
  • Votes 22
  • Parts 1
  • Time <5 mins
  • Reads 334
  • Votes 22
  • Parts 1
  • Time <5 mins
Clarence_writeslol
Ongoing, First published Nov 19, 2021
ahxufarawaywanderslaowenmpregpalacepriesttianyakewenkexingwordofhonorxianxiazhouzishu
Wen Kexing, the crown prince of the Xian kingdom, with his silver-white hair; was often seen as bad luck.

 As a god, his hair was not supposed to turn white due to his long life. But this wasn't the case for Wen Kexing. 

So, you might ask, why can his position as crown prince still be maintained until now? Eventhough he didn't want to be crown prince anymore because he had received too much humiliation from the emperor, his father himself.


To give his little wife, Zhou Zishu, a better life.
All Rights Reserved
ahxufarawaywanderslaowenmpregpalacepriesttianyakewenkexingwordofhonorxianxiazhouzishu
Table of contents

1 part

Sign up to add Fragrant Peach Blossoms (WENZHOU) (Eng. Ver) {MPREG} to your library and receive updates
or
#63priest
Content Guidelines
You may also like
NO MORE by Kritz_dream
33 parts Ongoing
Wei wuxian finds some interesting information about himself and the delusional life he had been living. He ended his life by commanding his army to attack their master, but now that he's back into the world of the living, he going about things a bit differently. _ Mdzs does not belong to me at all This is just my version of it. I've added some things about his past and certain instances which will cause a huge impact to original verse. I hope you enjoy!! __ Currently undergoing revision!!
The Emperor And His Husband by XxCatching_CloudsxX
2 parts Complete Mature
Wen Kexing of the Ghost Valley Manor marries the Emperor, Zhou Zishu of the Four Seasons Kingdom, in order to unite the Martial Arts World with the Imperial World. The Four Seasons Kingdom will gain protection, the Ghost Valley Manor will gain better reputation. There's a slight problem, though. Wen Kexing discovers a secret between the Emperor and his Personal Guard, Han Ying, and it creates a conflict within their already reluctant marriage.
The Baker and The Rockstar by XxCatching_CloudsxX
1 part Complete Mature
"Is this a bakery or a brothel?" Wen Kexing froze for a moment before standing up straight, his polite smile strained as he fully processed the words. "Are you blind or have you been raised like a barbarian? Wearing sunglasses and caps inside a building, the disrespect!" Wen Kexing shot back, angered at this man's attitude. The man seemed to be startled at that, his hand resting on the table twitched as he sat up from his slouch position. "You can't just talk to me like that." The man pointed out, to which Wen Kexing gave a laugh, "Says who?" "Says the general rules of customer service." "Screw the rules and screw you." ----- (Rockstar meets Baker, arrogant man and fierce man, who will win? Feat. White dyed hair Wen Kexing, bakery owner Wen Kexing, father of five Wen Kexing, gets his ass fucked Wen Kexing. Famous Zhou Zishu, shook at the disrespect Zhou Zishu, afraid of commitment Zhou Zishu, falls in love like a loser Zhou Zishu)
Word Of Honesty by unexistedusernew
31 parts Complete
An invisible red thread connects those who are destined to meet, regardless of time, place, or circumstances. The thread may stretch or tangle but never break. Wen Kexing: "Hold hands with you, grow old with you. Long for heart, never be apart." Zhou Zishu: "I'm afraid if you know the truth, you'll hate me." Han Ying: "You're My Lord. My life and my love is for you to own." MPREG warning!!!
(Not) According to Plan by XxCatching_CloudsxX
2 parts Complete Mature
This was not how Wen Kexing expected his life would turn into. Wen Kexing and the not so bad arranged marriage. (Random snippets following Wen Kexing's life of gay) (Might as well be pure smut ngl) (UPDATE: NOW WITH A REWRITE THAT IS MUCH LONGER! CHECK 2ND CHAPTER!) (I turned my original 3K fic to a 10.5K fic)
A Phoenix With No Wings by nataswan
59 parts Complete
She was born to be an empress. Beauty like immortal, talented in many aspects and a great politician. She married to the crown prince at the age of 11. Engendered two heirs for the kingdom. She really lives a perfect life. Shining crown and beautifully embroidered gown. Tingling hairpins on her head doesn't make her happy. Is it too greedy to ask for more? Is it insolent to say that she's unpleased with her life? Because the emperor never looked at her. Because he doesn't favor her, her days are full of sorrow. All she ever wanted is him.
Silver Lining [WenZhou] by plumofwinter
11 parts Complete Mature
Wen Kexing saves Zhou Zishu but loses himself. He wakes up with no memories and disappears. Zhou Zishu tries to find him but all his efforts go in vain, until one day he finds a familiar strand of hair twisted around a familiar hairpin. WenZhou fanfic / After immortality Available in Sinhala & Vietnamese
I Raised My Husband (Wangxian) by CangseSenran089
52 parts Complete Mature
this is my first time writing a story. please ignore my grammatical issues. warning: older Wei Wuxian and younger Lan Wangji. ABO story: Wei Wuxian who is most beautiful in Jianghu,determined to be an strong cultivator like his parents, turn into an Omega after his 15th birthday. His dream of becoming a cultivator got destroyed that day. That what he thought but fate had decided different future from him. He is to be Omega of the crown prince of Lan family taught him every things these the crown prince need to in 16 years even their Three thousand rules. what will happen when Lan Wangji know that Wei Wuxian is not his brother but his wife? Will he like Wei Wuxian who is twice older than him?
Wei Wuxian: The Primordial Abyss by Jillianmrls
9 parts Ongoing Mature
The Yiling Patriarch - Wei Wuxian's life ended during the First Siege of Burial Mounds. He is whispered in fear, his legends twisted in terror. But the gods saw everything. --- For the first time in eons, a mortal ascended into godhood beyond life and death, becoming both deity and domain. Wei Wuxian, with his golden-heart and boundless resilience, is crowned as the Primordial God of Underworld and Tartarus. His soul resonated with raw power of these realms. He rules as a being of unfathomable beauty and overwhelming might-a form form cloaked in shadow, with sharp, symmetrical features that could shame the most exquisite jade carvings. His crimson eyes glow. The wrath of Tartarus and the endless sorrow of the Underworld. His hair, long and black as the abyss, flows like a cascade of liquid night, while his smile-equal parts alluring and cruel-strikes terror into the hearts of even the gods. As Tartarus, Wei Wuxian commands chaos itself, imprisoning wicked deities, unruly spirits. As Underworld, he governs the balance of life and death, guiding lost souls, passing judgment. His carries a weight that bends reality; a single word can ignite storms or calm the roaring sea of the dead. --- Wei Wuxian stayed in his realm, thinking the world hates him. But unknown to him, he made a truth array in case anything went wrong, but forgot about it after. It was during the First Siege that people have disturb it with some other experimental talismans and the truths are revealed too late. ... 13 years later, Wei Wuxian is summoned in the living world from what he thought. He is worshipped as hero and deity. ❤️ Primordial God! Wei Wuxian AU ❤️
You may also like
Slide 1 of 9
NO MORE cover
The Emperor And His Husband cover
The Baker and The Rockstar cover
Word Of Honesty cover
(Not) According to Plan cover
A Phoenix With No Wings cover
Silver Lining [WenZhou] cover
I Raised My Husband (Wangxian) cover
Wei Wuxian: The Primordial Abyss cover

NO MORE

33 parts Ongoing

Wei wuxian finds some interesting information about himself and the delusional life he had been living. He ended his life by commanding his army to attack their master, but now that he's back into the world of the living, he going about things a bit differently. _ Mdzs does not belong to me at all This is just my version of it. I've added some things about his past and certain instances which will cause a huge impact to original verse. I hope you enjoy!! __ Currently undergoing revision!!

More details