Spirit Martial (Dreame App)
maantonnettesuson
  • Reads 382
  • Votes 24
  • Parts 5
  • Reads 382
  • Votes 24
  • Parts 5
maantonnettesuson
Complete, First published Jan 07, 2022
actionadventureboyslovefamilyfantasyfriendshippainromancesadnessteen
Reborn as a spirit caster and a lethal soul inside him has stirred, awaits a new journey to discover his actual power and a trusted partner. 

Born as an unwanted prince with a new breed of spirit within him, awaits a trial, deserted by parents but found a trusted partner.

Both worked together to discover themselves together as they try to find the Spirit Martial to save the realm. 

May the odds be in their favor.
All Rights Reserved
actionadventureboyslovefamilyfantasyfriendshippainromancesadnessteen
Table of contents

5 parts

Sign up to add Spirit Martial (Dreame App) to your library and receive updates
or
#109sadness
Content Guidelines
You may also like
Libertà University by winnowa
54 parts Complete
Libertà University also known as Libertà De Universidad. It is a university that is found hidden within the forestry of Mount Apo. A university that is built thousands of years ago. It is isolated in time and culture. Magic and power flows gracefully like the wind in this land. People who are accepted to be here are called lucky ones. -- Ariza De Fiesta had to go attend her Señior year in an unknown school that is recommended by her Auntie. Since she has no money to attend the usual universities in Davao City, she had no choice but to be enrolled in Libertà University which is found high and deep within the forestry of Mount Apo. She didn't know that magic and enchantments exits in this part of the country. She thought that she wouldn't be able to survive in this university when she met Xerxes Lionheart. Together, they solve the mysteries and puzzles that had been skeptical through ages inside the university. -- A/N: This book can be your source of happiness, joy and excitement but on the other hand it can be saddening, excruciating and irritating. Warning! You've been warned. :) All rights reserved
The Fairy Oddventure of Olympia by Illinoisdewriter
62 parts Complete
Olympia Sharlene Sagrado's life oddly seemed like a fairytale - her mother's death led to her father's remarriage to her evil stepmother, who tagged her equally wicked children to their home. After her father's demise, her stepmother, desperate to maintain her youth, becomes determined to hunt Olly down and sacrifice her. In her attempt to escape, Olly encounters a fairy godmother who transfers her powers and responsibilities just before the clock strikes midnight. Olly, now a human-turned-successor, inherits the role of a bibbidi-bobbidi-boo fairy, but not just any ordinary one. She becomes the fairy godmother of spirits, accompanied by two adorable spirit guardians and a handsome familiar possessing odd abilities. Together, they embark on an extraordinary oddventure as Olly navigates her newfound duty of granting the spirits' wishes while managing Batibot, the all-in-one shop for all things supernatural. Through her human ways of solving fairy problems, Olly will prove that she is the oddest of them all.
The Girl who Lived by jaydefied
50 parts Complete
Suffering from amnesia, Amity Villamor hopes to restore her picture-perfect life. She is the sole survivor of a grievous accident, but after a baffling encounter, she realizes that someone wants her dead. Troubled by strange memories and a peculiar ability, Amity decides to chase for answers. But things become deadlier when her search for the truth gets her tangled in a web of political intrigues, murders, and conspiracies. An unearthening of an enigma always comes with a price. Because amidst the lily-white image of Autumn Vale city, some people are not who they seem to be. And they are hiding something grim from the girl who lived.
The Luna is a Villainess by snowqueencel
38 parts Ongoing
The Luna is a Villainess (Ongoing) Lilian Ledger is one of the Falcon Mafia's top assassins. She's well known for her code name 'Luna' in the underground society due to the symbol of the moon on the hilt of her swords and her ethereal beauty. But no matter how skilled she is in her profession, Lilian tragically meets her end while saving an elderly woman from an accident. Magically, fate seems to have a different plan for her as she wakes up from the sight of a familiar and yet unknown place. That's when Lilian realized that she's been reborn inside her favorite novel as Selene Quincy, the villainess of the story who is also destined to die. And that's when her new mission to prevent her second death began. Though things will become more complicated the moment she meets the male lead of the story, the Duke-Apollo Heinrich. Lilian Ledger/Selene Quincy x Apollo Heinrich Disclaimer: This story is written in TagLish Book cover by: Gela Draws [[ ----- Date Posted: 09/21/24 Date Started: 09/22/24 Date Ended: Status: Ongoing Genre: Fantasy-Romance
That Nerd has a Secret (PUBLISHED UNDER PSICOM) by Mikasa_bolabola
78 parts Complete
She's not a gangster nor a mafia. Neither a lost princess nor a goddess. She's not a wizard or a guardian or other magical beings that exist in fantasies. Not an assassin, a model, or a spy. Powerful? Why don't you see for yourself? The title says it all. Do you want to know her secret? Then come and read this. -- Genre: Fantasy/Action/Romance Language: Taglish Can also be read on another website: Tales of Siren. You can click the link on my profile. No promoting of stories here please. This is not a book club. Thank you. Status: COMPLETED/EDITING Get your own copy of the book on Shopee or Lazada.
The Demon King's Only Weakness. by CDLiNKPh
39 parts Ongoing
A demon adopted a human baby. Ito na ba ang magpapabago sa buhay niya? Kwento ng demonyo na piniling mamuhay sa earth para magpalaki ng bata at mamuhay bilang tao.
Axphain Academy: School for Divine Angels by RonRaViolet
66 parts Complete
✔COMPLETED (New Version) | Axphain Academy: School for Divine Angels (Metanoia Series 3) Axphain is a nation of divine winged mythical creatures. Their domain was located beyond the clouds which is one of the convergence of their powers. They are the race of godlike beings and considered the most beautiful creation of Akwan. Divine angels have gold and white wings, which made them stand out for the rest of the six race of angels. They are living with pride, wealthy lifestyle, beauty, wisdom, and very conservative when it comes of traditions and beliefs. On the other hand, Serephain is a silent type who doesn't want to mingle with others because of one particular reason. She may be a silent but a deadly one. Serephain was living with secrecy over eighteen years, which is why she is already get used by telling lies. Not until her father decided to enroll her in Axphain Academy, a school for divine angels, which made her belief turns upside down. Because she is not just a divine angel but beyond extraordinary. Book cover was made by @desilexic
The Prophecy of Fates by Soul_of_Anubis
99 parts Ongoing
"You are fated to end the reign of the gods." After discovering the appalling truth behind her birthright, Ahlkria ends up in a position far from the reality she once lived-in and believed. Exploring places where she thought to have only existed in the books of history... And meeting new people whom she never even once dreamed of becoming a central part of her life. The semideuses: powerful half-mortal offsprings born of the gods themselves---and that unfortunately, she was one of them. With the bonds formed between the traces of their divine bloodlines that dated way back from the ancient gods of Greece, their journey begins to revolve around the awakening of an old broken tale written by the Fates themselves and delivered by one of the oracles of the Olympian god, Apollo. A lost prophecy that speaks of the salvation or the annihilation of mankind. An omen that haunts the future of the Olympian pantheon. And former enemies from the myths that were destined to bring upon the inevitable across the realms. In the end, can Ahlkria and the rest of our heroes triumphantly withstand the ultimate battle waged by none other than the ancient gods themselves? Or will their stories all wind-up lost and forgotten throughout the infinite passage of time?
Wind Chime (A Lucid Dream Spin-off) by alyloony
46 parts Complete
Lavender is in love with Yuan, the perfect guy--kind, sweet, charming, and a musician like her. The problem? He's not real. He only exists in her dreams. *** Lavender Laxamana can't sing or play the guitar in front of anyone anymore. She hides in her dreams where she can perform and play music to her heart's desire with Yuan. Lavender has already accepted that the man she loves is just a figment of her imagination, but when she crosses paths with Aki, a starting artist who goes by the name of Musikero and looks and sounds like Yuan, Lavender is hopeful they can finally be together in real life. But reality slaps her in the face when she finds out Aki is the exact opposite of Yuan, and he loathes her. While Lavender struggles to find the connection between Yuan and Aki, can she finally find the courage to stop escaping from reality--no matter that Aki may be in love with another woman? And can she finally face the rhythm and beats of her heart and pursue her passion again? How far will she go--or not go--for her dreams? DISCLAIMER: This story is written in Taglish. COVER DESIGN: Regina Dionela
Crown of Astria by Aria_Aeldra
72 parts Complete
✓ | Tagalog | Because of Astria Kingdom's wealth and economic success, the throne was broken by violence, the crown was earned by treachery. To seek revenge and justice, Prince Clyde Maxfield offers a prisoner named Avianna Elora freedom in exchange for helping him to gain the crown. Will she be able to get the crown or will this lead to her death? Highest Rank: #1 in Action, #2 in Adventure Genre: Fantasy, Romance, Action, Adventure Book cover illustrated by: Saiidesigns
You may also like
Slide 1 of 10
Libertà University cover
The Fairy Oddventure of Olympia cover
The Girl who Lived cover
The Luna is a Villainess cover
That Nerd has a Secret (PUBLISHED UNDER PSICOM) cover
The Demon King's Only Weakness. cover
Axphain Academy: School for Divine Angels cover
The Prophecy of Fates cover
Wind Chime (A Lucid Dream Spin-off) cover
Crown of Astria cover

Libertà University

54 parts Complete

Libertà University also known as Libertà De Universidad. It is a university that is found hidden within the forestry of Mount Apo. A university that is built thousands of years ago. It is isolated in time and culture. Magic and power flows gracefully like the wind in this land. People who are accepted to be here are called lucky ones. -- Ariza De Fiesta had to go attend her Señior year in an unknown school that is recommended by her Auntie. Since she has no money to attend the usual universities in Davao City, she had no choice but to be enrolled in Libertà University which is found high and deep within the forestry of Mount Apo. She didn't know that magic and enchantments exits in this part of the country. She thought that she wouldn't be able to survive in this university when she met Xerxes Lionheart. Together, they solve the mysteries and puzzles that had been skeptical through ages inside the university. -- A/N: This book can be your source of happiness, joy and excitement but on the other hand it can be saddening, excruciating and irritating. Warning! You've been warned. :) All rights reserved

More details