The Devils Consigliere
The100Bellamygirl
  • Reads 10,745
  • Votes 152
  • Parts 39
  • Time 9h 1m
  • Reads 10,745
  • Votes 152
  • Parts 39
  • Time 9h 1m
The100Bellamygirl
Complete, First published Jan 10, 2022
Mature
agegaparrangedmarriagedangerdarkromancegrumpyitalianmafiamafiaprincessnewyorkrichromancesunshinetoxicwealthy
*Not my photo*

TRIGGER WARNINGS- abusive behaviour (verbal, mental, domestic), dark topics (child abuse, child neglect, etc), cheating, death, gun violence, fat-phobia, explicit sex scenes, torture, extreme violence, toxic relationships, forced marriage, slut-shaming, and underage drinking. 

*the cheating storyline is prior to love story
*this dark romance centres somewhat around the abuse
*all dark topics are a side storyline of the story 

Toxic mafia romance set in present day New York. 

Serena Bruno turned Serena Caroselli, the new and improved wife of La Cosa Nostra capo, Aurelio Caroselli. 
A spoiled, brat-like, irritation in his eyes. In the eyes of others, a prepped, stunning charmer. 

Her husband-through an arranged marriage, Aurelio Caroselli, of the high-ranked Caroselli family. A trigger-happy, no nonsense, bastard in her eyes. In the eyes of others, an apathetic killing psycho. 

Through a year of whirlwind chaos, the two find themselves in and out of a truce of peace. Their personalities and mannerisms as alike to Motley Crüe and Katy Perry. In two different worlds. 

Book 1 of 3.
All Rights Reserved
agegaparrangedmarriagedangerdarkromancegrumpyitalianmafiamafiaprincessnewyorkrichromancesunshinetoxicwealthy
Table of contents

39 parts

Sign up to add The Devils Consigliere to your library and receive updates
or
Content Guidelines
You may also like
Half A Heartbeat Away by DramaQueenforreal
42 parts Ongoing
MAFIA ROMANCE [WEEKLY UPDATES🤭] Beckham Blackford, head of the English mafia, had no time to mourn the death of his murdered wife, as he needed a new mother figure for his two kids. Enters the Italian mafia boss' daughter, Milena Ricci, only 20, she's forced to marry Beckham and become the nanny/mother figure for the kids. They still need to figure out who carried out the murder that led them to this predicament, and navigate this new life on eggshells, inside and out. Sounds easy, but it's more complicated than that. Tropes: Arranged Marriage, Forced Proximity, One Bed Trope, He falls first and harder, Age Gap (11 years), Present Dad, No Cheating. ALL RIGHTS ARE RESERVED. -Highest Rankings: #1 in MarriageOfConvenience #2 in FakeRelationship #1 in DarkAcademia #54 in MobBoss #50 in ForcedProximity #16 in SingleParent #8 in Marriage
Dangerously Her by Msbirdyy
35 parts Complete Mature
**𝐖𝐀𝐑𝐍𝐈𝐍𝐆**( under heavy changes and editing) This story will have sensitive topics that meant be triggering to some readers. So please be advised. Heyy, guys so I made this story when I was pretty wrong and now going back and reading, I've decided to edit and improve the story line and ending!!!!! 𝐕𝐢𝐜𝐭𝗼𝐫𝐢𝐚 It's hard to love someone after what happened. It change me, it mold me. Living is pointless, I found myself thinking sometime all it takes it one bullet to the head. The need to stay high from drinking is the only thing holding me together until I meet 𝐇𝐢𝗺. Him with those gray eyes who gives me a reason for me to want to breathe. He who makes me feel alive with one touch , who every time I see my heart beats faster but my lungs slower. Loving just hurts so what's the point in love if it will only hurt you. 𝐋𝐮𝐜𝐚 She has that stone cold face but when you look into 𝐡𝐞𝐫 eyes you see the pain. The pain she hides from others and dwells when alone. Who can hurt a beautiful creature like that but who am I to judge when I myself have hurt her. In my world love is a weakness that will bring you to your knees for the one in your heart. No matter how hard I try , I can never forget 𝐡𝐞𝐫 but what's the point of loving if it will only hurt you. Victoria Mary Santos is the fearless badass daughter of the Spanish Mafia. She will do anything to seek her revenge on her assaulter who almost broke her. And by all means anything, she is willing to except an arranged marriage.
MAFIA'S PIANIST ✔ by Delirus
47 parts Complete Mature
"𝘈 𝘮𝘢𝘯 𝘸𝘪𝘵𝘩 𝘮𝘶𝘳𝘥𝘦𝘳 𝘰𝘯 𝘩𝘪𝘴 𝘩𝘢𝘯𝘥𝘴 𝘢𝘯𝘥 𝘢 𝘸𝘰𝘮𝘢𝘯 𝘸𝘪𝘵𝘩 𝘮𝘶𝘴𝘪𝘤 𝘪𝘯 𝘩𝘦𝘳 𝘩𝘦𝘢𝘳𝘵" "No?" he questioned as her eyes flew open and she nodded. "It wasn't an option baby" he whispered as he placed a kiss on her thin neck, making her shiver and clutch onto his suit "When I say something you do it" "N-No" her answer wavered and his grip on her jaw tightened. He noticed a small adhesive bandage on her neck from when the knife dug at her skin yesterday. His thumb caressed the spot as her heartbeat quickened "See" his eyes met hers "I didn't even touch you yesterday, but you already have a bruise. What do you think will happen when I finally make you mine?" She gulped hard but refused to give up to a person who was practically a stranger to her "I'm not yours" she breathed out. "Again, not an option baby" ▁▁▁▁▁▁▁▁ Abigor Hayes, the mafia feared by nations. He was known for committing every single crime that the world has known, but never getting caught for it. Being the current head of the powerful Hayes family, no one could even touch him. What happens when the Mafia King attends the annual ball and meets Aria Leighton, a woman with unearthly beauty and magic in her fingers? He now wanted what he shouldn't have, but are things really as simple as Aria makes them seem to be?
Perfectly broken by MarieeStuartt
39 parts Ongoing Mature
"Say the right words carrisima and I am yours." Dante Russo, don of the italian mafia, marries the daughter of his ennemy. He intends to make her life unbearable and break her heart into million pieces just to take revenge from her father. But, can he break what is already broken ? Maybe, after all, he will be the one to fix it. Anastasia Perez, daughter of the capo of the Spanish mafia, marries her ennemy with a plan to take him down. But, for once in her life, feelings get mixed with business. They married each other with bad intentions. But, fate seems to have another plan for them. Will they reach their goal, especially when they fall madly in love with each other ? What are they willing to do for love ? Tropes Arranged Marriage Forced proximity Enemies to lovers Mafia Romance
Dark Chemistry |18+| (Not Edited) by Leia_LittleBee
58 parts Complete Mature
"Everything of you is a non-existing dangerous drug, Natalia. And I'm addicted to it." He rasped beside my ear then slowly but seductively brushed his nose on my neck and then my hair like he was smelling my body and my hair. I stopped breathing as I started feeling like I was going to pass out. ❥ If you start loving someone from deep down your heart, you will stop caring about the hurts, miseries, anguishes and traumas that he/she once caused in your life. You'll even be ready to sacrifice your own life for him/her. Love can change your miseries and traumas into peace and happiness, love can change an emotionless monster into a loverboy. If you don't want to love or don't want to be loved then love won't wait for your permission. You won't even realize 'where, when and how' you fell in love. Love can destroy you within a blink, love can bring you happiness and love can even kill you with no mercy. ✧⁠*(⁠◍⁠•⁠ᴗ⁠•⁠◍⁠)✧⁠*⁠。 Natalia Rauf, a simple Bangladeshi girl, was living a peaceful life filled with family warmth, laughter, and the carefree joys of school and friendship. But all of that changed one night like a nightmare. The pull of the forbidden was irresistible, especially for an eighteen-year-old like her, craving excitement with her best friends. They sneaked into an infamous club to discover its secrecy and have fun. Tucked away from the usual haunts, the place thrummed with an eerie allure, promising both thrill and peril in equal measure. They enjoyed, really enjoyed. Unbeknownst to her, a predator's eyes followed her every move from the VIP balcony, lurking in the shadows. What began as a harmless night out would soon spiral into a deadly game of cat and mouse, forcing her to confront the terror of being hunted by a man with no mercy. " Highschool girl × Italian Mafia Boss " DARK ROMANCE BOOK! #1 in kidnap #4 in darkromance #3 in dark ⚠️ Mature contents (DON'T STEAL MY IDEAS)
The Edge of Light ✔️ by chuppauthor
43 parts Complete Mature
In a world built on lies, violence, and power, there's no room for softness-especially not in the hearts of those who rule. Nikolai, a ruthless mafia kingpin hardened by betrayal and tragedy, has never questioned his grip on control. That is until Elena, a woman born into a life of privilege yet haunted by her own darkness, crosses into his domain. Torn between their fierce attraction and the impossibility of love in their deadly world, they find themselves bound by secrets neither is prepared to reveal. But when betrayal strikes, and Elena seizes a fleeting chance at freedom, Nikolai's world threatens to unravel. Obsessed with her every move, he's forced to confront his deepest fear: has his love become a cage? And if so, can either of them truly escape? Danger, desire, and deception collide in this heart-pounding mafia romance, where loyalty means everything-and nothing is what it seems.
The Unspoken Vow by authordelune
28 parts Complete Mature
An arranged marriage. An unexpected love story. ~~~ To her, happy ever afters only exist in books, and she believes that dreams are inevitable, but never expect them to become a reality, so she swears to never hope. To him, happy ever afters don't exist and dreams are for children, so he believes in neither. They are bound by marriage, one she didn't expect and one he knew of all along. Their beliefs are tested and both are left wondering what's true, what's right and what's most important. ~~~ Completed!! :) and thanks for reading 🤍
Mafia Arranged Marriage by DramaQueenforreal
44 parts Complete
COMPLETED✅ Arturo Vasquez -Head of Spanish mafia- was planning on accepting the proposal of Russian mafia leader Ivan Volkov's for his daughter, Aiyana, for her hand in marriage. Laying the cards down on the table, Marco Dominic Valentino - Head of the Italian mafia - makes a better counteroffer, hence it's settled that Aiyana would marry Amren Valentino, the heir for the Italian mafia. They only met once before they're married, but sometimes once is enough. Challenges and hurdles thrust their way left and right, leaving the couple no chance but to manifest this fake relationship into something real. ❣️•••❣️ Excerpt : "I think I'm strong enough to handle myself" She confesses with specks of anger darting through her eyes. I groan "You are, but it doesn't mean I like you being away from me in case anything happens" I stress my words, my breath hitting her face in gentle waves. "Shall you put me on a leash too?" She spits defiantly, smelling the tinge of alcohol on her breath, the knife digging deeper into my skin, I feel it's only moments away from piercing through my skin. My eyes snap to her angry contortions, her eyebrows furrowed, mouth slightly agape. "Come on, dance with me. The earth is spinning, we can't just stand on it" ❣️•••❣️ *I do not own any of the pictures used in this book, they belong to their rightful owners. *contains cursing. *contains mature themes. *focuses more on the romantic aspect, but I guarantee there's some action;) HIGHEST RANKINGS: #1 in mafiamarriage #7 in ForcedMarriage #1 in mafiaking #1 in arranged #10 in arrangedmarriage #1 in fastpaced #1 in fake #1 in darkacademia #3 in mafia #1 in marriage #6 in completed #4 in youngadult #1 in enemies #1 in enemiestolovers #1 in drama #1 in spicy
Three Husbands One Wife (18+) by Ozellamoon
27 parts Ongoing Mature
| Forced Marriage | Dark Romance | Polyamorous | (Revamped Version) 18+ If you are underaged please click off now! Used to have 600K readers until it got taken down Marriage combines two souls together in love, through sickness and in health until death do them part but this marriage isn't about love, no this marriage was broken from the start but who will be the first to fix it? The Romano family, the most notorious criminals in all New York to Italy. They own the scandalous BDSM club in all of Brooklyn New York. They are known as dominating and out right terrifying. They never settled down, they never found the right women. God forbid they ever do. Carina Lopez a timid spitfire who's not to be messed with. Her life was always about survival, the bruises and scars that has only fueled her flame. No one can tame her, not until they came into her life. what happens when a battle arises? Where secrets and lies come to the surface? Will she find answers? Will carina survive? Will she learn to love them? Or will they break her until she has no shelter but them. _________________________________________Quotes: "Are you kidding me! First murder and now arson!" "The collar does not come off unless we take it off" "Keep it up carina, I'm not dealing with your bratty behavior today."
𝐂𝐇𝐀𝐒𝐈𝐍𝐆 𝐒𝐄𝐑𝐄𝐍𝐀 1.1 [𝙲𝙾𝙼𝙿𝙻𝙴𝚃𝙴]✔️ by Hjaynee
24 parts Complete Mature
-𝐀 𝐌𝐀𝐅𝐈𝐀 𝐑𝐎𝐌𝐀𝐍𝐂𝐄- ~𝐁𝐨𝐨𝐤 𝐎𝐧𝐞 𝐨𝐟 𝐭𝐡𝐞 𝐈𝐋𝐋𝐈𝐂𝐈𝐓 𝐒𝐄𝐑𝐈𝐄𝐒~ [CAN BE READ AS STANDALONES] ~•~ 𝐒𝐄𝐑𝐄𝐍𝐀 𝐑𝐔𝐒𝐒𝐎 A daughter of a mafia boss was not easy for her, living under the ruling of men, every step was watched during her life and yet all she wants to do is be included, defeat criminals with her father, but she gets turned down continuously. Yet her brother has been accepted into the mafia with open arms which only angers Serena and causes her envy to grow. 𝐃𝐈𝐄𝐆𝐎 𝐆𝐑𝐄𝐂𝐎 A powerful family friend you could say, but when he and his father are called to help the Russo family he is more than pleased to take up the offer, but fighting off his own barriers were enough to cause him to lose his own mind as certain secrets are unravelled. Secrets are hidden, problems occur. Will Serena get what she wants or back down and let the men handle it? And will there be any hope for the Italian mafia? ~•~ This story contains: -Minor sexual language/content -Mature language/content First chapter published: 23rd March 2021 Completed: 9th May 2021 Fully edited: 21st September 2021 AN: Thank you so much for reading my book! I really appreciate it and hope you enjoy it! Every vote and comment is appreciated! Thank you! 1K VIEWS = 14th May 2021 5K VIEWS = 29th AUGUST 2021 10K = 25th DECEMBER 2021 20K = 24th June 2022 30K = 25th Feb 2023 50K = 21st Jul 2024 #3 in Nicolas (8th August 2021)
You may also like
Slide 1 of 10
Half A Heartbeat Away cover
Dangerously Her cover
MAFIA'S PIANIST ✔ cover
Perfectly broken cover
Dark Chemistry |18+| (Not Edited) cover
The Edge of Light ✔️ cover
The Unspoken Vow cover
Mafia Arranged Marriage cover
Three Husbands One Wife (18+) cover
𝐂𝐇𝐀𝐒𝐈𝐍𝐆 𝐒𝐄𝐑𝐄𝐍𝐀 1.1 [𝙲𝙾𝙼𝙿𝙻𝙴𝚃𝙴]✔️ cover

Half A Heartbeat Away

42 parts Ongoing

MAFIA ROMANCE [WEEKLY UPDATES🤭] Beckham Blackford, head of the English mafia, had no time to mourn the death of his murdered wife, as he needed a new mother figure for his two kids. Enters the Italian mafia boss' daughter, Milena Ricci, only 20, she's forced to marry Beckham and become the nanny/mother figure for the kids. They still need to figure out who carried out the murder that led them to this predicament, and navigate this new life on eggshells, inside and out. Sounds easy, but it's more complicated than that. Tropes: Arranged Marriage, Forced Proximity, One Bed Trope, He falls first and harder, Age Gap (11 years), Present Dad, No Cheating. ALL RIGHTS ARE RESERVED. -Highest Rankings: #1 in MarriageOfConvenience #2 in FakeRelationship #1 in DarkAcademia #54 in MobBoss #50 in ForcedProximity #16 in SingleParent #8 in Marriage

More details