That Time I Got Reencarnated as a Demon Lord (English)
Lord447
  • Reads 90,813
  • Votes 3,117
  • Parts 68
  • Time 16h 25m
  • Reads 90,813
  • Votes 3,117
  • Parts 68
  • Time 16h 25m
Lord447
Ongoing, First published Feb 01, 2022
badbadrimurufanficfanfictionfantasyficmonsteroverpowerrimururimututempestslimetenseishitaraslimedattakentssdktssdkfanfictssdkficwar
We all know the story of how Satoru Mikami, the 37-year-old salaryman, died and was reincarnated in another world where he became the most powerful slime in slime history. But... what if he were a little younger.

In this fic we will see the story of a high school student Satoru Mikami, aged 17, who while returning home with his best friend ends up being stabbed by a robber. In the moment before he dies, Satoru hears a voice carcastically answering his every word and... well, then you can imagine what happens.

What will the journey of Rimuru, the most powerful slime, be like now that his age, experiences and priorities, as well as his sense of right and wrong, are so different?
All Rights Reserved
badbadrimurufanficfanfictionfantasyficmonsteroverpowerrimururimututempestslimetenseishitaraslimedattakentssdktssdkfanfictssdkficwar
Table of contents

68 parts

Sign up to add That Time I Got Reencarnated as a Demon Lord (English) to your library and receive updates
or
#64monster
Content Guidelines
You may also like
Tensura: The Odyssey by Neo_061
10 parts Ongoing
Mikami Satoru was just an ordinary salaryman-until fate transformed him into a slime in a fantastical new world. Now, he must navigate a realm teeming with Dragons, Demon Lords, Saints, and other mystical beings. Facing trials and triumphs, his journey is anything but ordinary. How will he fare in this new journey of his? Witness the odyssey of his new slime life - his slife.
Reincarnated as Rimuru's Ultimate Skill by Joeazar2006
5 parts Ongoing
A silver-haired Japanese girl obsessed with the manga "That Time I Got Reincarnated as a Slime" never imagined her love for the story would transport her into its world-literally. After an unexpected accident, she wakes up not as a person, but as a powerful skill within Rimuru Tempest, the very protagonist she adored. With all the abilities she wished for during her final moments, she becomes the sentient core of Rimuru's Ultimate Skill, guiding him in his rise to greatness. As Rimuru evolves, so does she, bound to the hero she loves while secretly shaping the fate of their shared world. Can she protect Rimuru and their world from unseen dangers, or will her overwhelming power lead to unexpected consequences? An isekai tale of devotion, power, and the ultimate fan's dream come true!
Ruler of Monsters by NullAzatoth
8 parts Ongoing
Slimes are the weakest?. let's change that. what if. Slimes were more terrifying. And Rimuru the was the original Slime. he wasn't a god or deity, just a slime. an Overly powerful and yet respected man. THE PRIMORDIAL OF ALL MONSTERS, A SLIME. Devourer Rimuru Tempest Slimes will be a bit OP here and not weak. But general slimes are weak.
Reborn into this World by Raven432010
9 parts Ongoing
(Rimuru x Youjo Senki Crossover) This story follows Rimuru, a monster who died at the hands of Hinata Sakaguchi. He is a lost soul who drifted away from his origin and into another domain of a god. Miraculously, he survived an attempt during his reincarnation by a being who wished to destroy him, successfully being reborn into a new world, he navigates his new life, facing many challenges, conflicts, and hidden threats. He learns to harness his powers while uncovering the truth about his past and the divine forces that still seek to destroy him. Can he find his place in this world, or will the shadows of the past come back to haunt him?
Tensura - Beyond Expectations by Rimuru6360
43 parts Complete
A 15 year Otaku girl died while saving a lady from a robber, when she thought her life was over, she got reincarnated in Rimuru's body when he first reincarnated in the tensura world. Now follow Yuu (later named Rimuru) in her adventure. Tensura fanfiction, but an OP main character from the start, HOW!! Just read and find out. Note - This book is the continuation of Rimuru Journey. Note - English is a secondary language, so grammar and spelling mistakes are common. And I don't own "THAT TIME I GOT REINCARNATED AS A SLIME" I only own this fan fiction story.
Tensura: The Slime and the Hybrid by Bokilin
45 parts Ongoing
A man named Satoru Mikami is killed during a botched mugging and finds his soul reincarnated into the body of a Slime. But he finds himself not alone, as he comes across another being who claims to not remember who he was and they decided to help out each other out as they explore this world and see what it holds.
A Blade Made of Slime by WillsterEdge
40 parts Ongoing Mature
One day, Rimuru wakes up only to find that he's once again been reincarnated into another world. Only instead of being a Slime, he's been reincarnated as something completely different, a Sword? How will Rimuru get used to a new world that goes by a completely different set of laws?
That Time I Got All The Ladies (Book 1) by Devvytmz
49 parts Complete Mature
Have you ever wondered what things would be like if Rimuru actually stuck to what he had said when he died? "In my next life, I'm gonna go on the prowl! I'll hunt down all the ladies!" Well, let's find out together as Rimuru starts his next life in his new world. A slime, yes, but a slime on the prowl. Just a fun little story I thought up while thinking of what next to write with my current tensura story. That said, this book has nothing whatsoever to do with that ever-lasting book pretending to be a small novel. No, this is its own thing so have fun reading!
Rimuru back 3000 year as a Fifth True Dragon by EliteX0
22 parts Ongoing
During the Final Battle Against Feldway, he had inevitably sent Rimuru to the end of time and space. After Feldway send Rimuru to the end of time and space Rimuru decide to find a way to go back when he's wake up However, Chrono-Saltation, had not only thrown Rimuru to the end of time and space, but it had also locked him out from returning to the world using Space-Time Leap. As if banning Rimuru's existence itself from the world, preventing his return. And Ciel also tell him that his timeline had already destroyed so he cannot go back after hearing that Rimuru start to feel a lot of emotion inside him sadness regret and pain all the emotions you can think of come to him at once and start to make him go insane In the end, Ciel find a way to time travel to the past but risk is to high it can destroy rimuru's Spiritual body, if anything goes wrong. And so can rimuru go back in a time unharmed ? And what will be the consequences of it ? In this fan-fiction, Rimuru will be OP, respectful, serious when needed, and goofy. There will be other characters that will be more powerful than Rimuru at the start. (Keep in Mind, this is Fan-Fiction. So not everything here will be accurate and a lot of things will be changed.) All Rights Reserved
That Time I Got Reincarnated ... As Kiana Kaslana? by Lavi_Stories
37 parts Ongoing Mature
Fem Rimuru/Kiana Satoru Mikami was a normal japanese man playing his favorite game Honkai Impact 3rd ... But he was stabbed when he helped his junior from a mysterious man holding a knife. What if he was reincarnated, What if he was turned into the character he know so much about. Follow Satoru Mikami's journey as he travelled an unkown world full of wonders That Time I Got Reincarnated As A Slime and Honkai Impact 3rd belongs to their rightful owners.
You may also like
Slide 1 of 10
Tensura: The Odyssey cover
Reincarnated as Rimuru's Ultimate Skill cover
Ruler of Monsters cover
Reborn into this World cover
Tensura - Beyond Expectations cover
Tensura: The Slime and the Hybrid cover
A Blade Made of Slime cover
That Time I Got All The Ladies (Book 1) cover
Rimuru back 3000 year as a Fifth True Dragon cover
That Time I Got Reincarnated ... As Kiana Kaslana? cover

Tensura: The Odyssey

10 parts Ongoing

Mikami Satoru was just an ordinary salaryman-until fate transformed him into a slime in a fantastical new world. Now, he must navigate a realm teeming with Dragons, Demon Lords, Saints, and other mystical beings. Facing trials and triumphs, his journey is anything but ordinary. How will he fare in this new journey of his? Witness the odyssey of his new slime life - his slife.

More details