That Time I Got Reencarnated as a Demon Lord (English)
Lord447
  • Reads 90,056
  • Votes 3,115
  • Parts 68
  • Time 16h 25m
  • Reads 90,056
  • Votes 3,115
  • Parts 68
  • Time 16h 25m
Lord447
Ongoing, First published Feb 01, 2022
badbadrimurufanficfanfictionfantasyficmonsteroverpowerrimururimututempestslimetenseishitaraslimedattakentssdktssdkfanfictssdkficwar
We all know the story of how Satoru Mikami, the 37-year-old salaryman, died and was reincarnated in another world where he became the most powerful slime in slime history. But... what if he were a little younger.

In this fic we will see the story of a high school student Satoru Mikami, aged 17, who while returning home with his best friend ends up being stabbed by a robber. In the moment before he dies, Satoru hears a voice carcastically answering his every word and... well, then you can imagine what happens.

What will the journey of Rimuru, the most powerful slime, be like now that his age, experiences and priorities, as well as his sense of right and wrong, are so different?
All Rights Reserved
badbadrimurufanficfanfictionfantasyficmonsteroverpowerrimururimututempestslimetenseishitaraslimedattakentssdktssdkfanfictssdkficwar
Table of contents

68 parts

Sign up to add That Time I Got Reencarnated as a Demon Lord (English) to your library and receive updates
or
#53monster
Content Guidelines
You may also like
Tensura: The Odyssey by Neo_061
9 parts Ongoing
Mikami Satoru was just an ordinary salaryman-until fate transformed him into a slime in a fantastical new world. Now, he must navigate a realm teeming with Dragons, Demon Lords, Saints, and other mystical beings. Facing trials and triumphs, his journey is anything but ordinary. How will he fare in this new journey of his? Witness the odyssey of his new slime life - his slife.
Reborn into this World by Raven432010
9 parts Ongoing
(Rimuru x Youjo Senki Crossover) This story follows Rimuru, a monster who died at the hands of Hinata Sakaguchi. He is a lost soul who drifted away from his origin and into another domain of a god. Miraculously, he survived an attempt during his reincarnation by a being who wished to destroy him, successfully being reborn into a new world, he navigates his new life, facing many challenges, conflicts, and hidden threats. He learns to harness his powers while uncovering the truth about his past and the divine forces that still seek to destroy him. Can he find his place in this world, or will the shadows of the past come back to haunt him?
Rimuru's new adventure in Yggdrasil by ParadexTM
17 parts Complete
In this Fanfic Rimuru goes to a World called Ygddrasil (Overlord). He will start from the very bottom as a Slime .. Will he rise again?
The Last Regret - That Time I got reincarnated as slime by IsTaz2
39 parts Complete
Rimuru achieved everything which was possible but there is one regret he has in his mind even after the 12 years of the great war that he cant save his 'Destined One' So after 12 year he Decided to clear this regret but he don't want to change the whole timeline by directly interfering so he decided to live the whole life again after being reincarnated but this time he has every skill from the moment he reincarnated. Note: I changed rimuru personality a little bit after ch4 , I made him act like evil sometimes. The story also started to change after ch4, You would only be spoiled the events and character names of ln. Thanks @VytsuDesigns for the cover.
Rimuru the First Demon Lord by VioMC12
19 parts Ongoing Mature
In this story, rimuru has died but due to his wishes he went back in time and become a slime? now with his new found powers and skills, he strod off into the unknown and it seems he is not a normal slime but a demon slime? and he is the only SENTIENT BEING IN THIS REALM! Now surrounded by mindless demons, what will this slime do? Rimuru due to his strong if not stronger soul changes his gender into a male Instead of veldora, veldanava will be his 'sworn friend' since there are almost no other sentient beings other than a few Rimuru will also later evolve into a primordial instead of being one from the beginning. don't ask me how I don't know either Rimuru and ciel will also be with each other wayyy longer hence they become a bit 'EXTREMELY YANDERE ON EACH OTHER' uhmm a bit obsessive. also my first time writing a story + haven't read the light novel but kinda know the order and story to an extend + I'm a 6th grader so I don't know a lot of words I can use for my story to express my story BUT I hate spelling mistakes and will probably not make any but a few. I do not own the tensura series or light novel it belongs to fuze san(I think that's his name?) also if any one copies my story without my permission I WILL SEND YOU TO JESUS Taking inspiration is very much allowed
Rimuru back 3000 year as a Fifth True Dragon by EliteX0
22 parts Ongoing
During the Final Battle Against Feldway, he had inevitably sent Rimuru to the end of time and space. After Feldway send Rimuru to the end of time and space Rimuru decide to find a way to go back when he's wake up However, Chrono-Saltation, had not only thrown Rimuru to the end of time and space, but it had also locked him out from returning to the world using Space-Time Leap. As if banning Rimuru's existence itself from the world, preventing his return. And Ciel also tell him that his timeline had already destroyed so he cannot go back after hearing that Rimuru start to feel a lot of emotion inside him sadness regret and pain all the emotions you can think of come to him at once and start to make him go insane In the end, Ciel find a way to time travel to the past but risk is to high it can destroy rimuru's Spiritual body, if anything goes wrong. And so can rimuru go back in a time unharmed ? And what will be the consequences of it ? In this fan-fiction, Rimuru will be OP, respectful, serious when needed, and goofy. There will be other characters that will be more powerful than Rimuru at the start. (Keep in Mind, this is Fan-Fiction. So not everything here will be accurate and a lot of things will be changed.) All Rights Reserved
A Blade Made of Slime by WillsterEdge
40 parts Ongoing Mature
One day, Rimuru wakes up only to find that he's once again been reincarnated into another world. Only instead of being a Slime, he's been reincarnated as something completely different, a Sword? How will Rimuru get used to a new world that goes by a completely different set of laws?
Tensura: The Slime and the Hybrid by Bokilin
42 parts Ongoing
A man named Satoru Mikami is killed during a botched mugging and finds his soul reincarnated into the body of a Slime. But he finds himself not alone, as he comes across another being who claims to not remember who he was and they decided to help out each other out as they explore this world and see what it holds.
Re:zero x Rimuru by AzukoTEMPEST
13 parts Complete
Hello Readers, Welcome To, The world of Chaos and beauty Re:Zero x Rimuru Thank you for joing I hope you'll enjoy the story..To all the awesome people who are helping me to Improve. Thank you! I'm not that good of a writer but, I do enjoy it a lot. So, seeing people helping me really makes me happy I'm not a professional so you might find an insane amount of mistakes so please let me know so I can fix it I tried hard to make this story properly understandable.But as much as inexperienced I am...you guys are the judges. please give me some suggestions for improving the story. I don't know how to explain but,one thing for certain this story contain spoilers! Most of you must be thinking about how weird this description is but you see I'm not yet experienced to describe the story properly but, It's been 100,000,000 Year's world has Changed as well as our lovely slime. He has evolved into a being whose Rage could be The end of existence. Due,To boredom Rimuru decides To resign from being the king and wants To traveller the other worlds outside the veldanavas creation In process of doing So he found a place where Many species lived it was a world of Chaos and beauti Where elf's human's demons and whites lived due to Rimuru's admiration towards elf's he choses to stay there for a while. After he entered the world he meets a beautiful half elf and her friend puck. Will he able to make the elf's and the girls his own let's see what happens.. DISCLAIMER. This Rimuru Tempest Might have a different personality than the Rimuru we know the only thing changed in his personality is he's become more like veldora and milim childish.. This story also contains bad word's and sexual stuff..and yes i don't own any characters and also some of the image's
Rɪᴍᴜʀᴜ's Rᴀɢᴇ (Rewriting) by murgakukuu
19 parts Ongoing
What If Rimuru Came Back To Tempest Too Late? What If Rimuru Saw His People Dead In Front Of Him? What If Rimuru Went Evil? What If The Story Didn't Go As It Should And Took A Different; An Evil Route? Let's Find Out- This Is A Fanfiction About 'What If Rimuru Went Evil'. I Do Not Own 'That Time I Got Reincarnated As A Slime'. The Credit Goes To The Writer 'Sir Fuze'. I Own The Fanfic Named 'Rimuru's Rage'.
You may also like
Slide 1 of 10
Tensura: The Odyssey cover
Reborn into this World cover
Rimuru's new adventure in Yggdrasil cover
The Last Regret - That Time I got reincarnated as slime cover
Rimuru the First Demon Lord cover
Rimuru back 3000 year as a Fifth True Dragon cover
A Blade Made of Slime cover
Tensura: The Slime and the Hybrid cover
Re:zero x Rimuru cover
Rɪᴍᴜʀᴜ's Rᴀɢᴇ (Rewriting) cover

Tensura: The Odyssey

9 parts Ongoing

Mikami Satoru was just an ordinary salaryman-until fate transformed him into a slime in a fantastical new world. Now, he must navigate a realm teeming with Dragons, Demon Lords, Saints, and other mystical beings. Facing trials and triumphs, his journey is anything but ordinary. How will he fare in this new journey of his? Witness the odyssey of his new slime life - his slife.

More details