FNaF - William's First Victim
BlueAlastor
  • Reads 38
  • Votes 1
  • Parts 1
  • Time <5 mins
  • Reads 38
  • Votes 1
  • Parts 1
  • Time <5 mins
BlueAlastor
Complete, First published Feb 16, 2022
aftonfamilycharlieemilyglitchtrapvincentaftonwilliamafton
What happened after Events of Second Book

FNaF belongs to Steel Wool Studios, previously belonged to Scott Cawthon
Public Domain
aftonfamilycharlieemilyglitchtrapvincentaftonwilliamafton
Table of contents

1 part

Sign up to add FNaF - William's First Victim to your library and receive updates
or
#17vincentafton
Content Guidelines
You may also like
Rafe Cameron Imagines (for horny bitches) by MMM1315
28 parts Ongoing
SEXy Rafe Cameron Imagines for b*tches who need a good, god damn fantasy
𝙘𝙡𝙤𝙨𝙚 𝙩𝙤 𝙮𝙤𝙪 • 𝙧𝙖𝙛𝙚 𝙘𝙖𝙢𝙚𝙧𝙤𝙣 by delicatessss
59 parts Ongoing
A Maybank and A Cameron? It's almost like a modern Romeo and Juliet. It's forbidden for them to be together. Could be the end of the world. The stolen glances, the hidden feelings, the unspoken words, the secret meetings and the obvious hatred towards each other followed by constant conflicts and some hidden past that threatened them but there are always invisible strings tied and pulling them together no matter how hard the tides trying to pull and part them away from each other.
Behind the Mask (001xY/N fanfiction) by deliaaaana
34 parts Ongoing
Y/N, a simple woman, joins the deadly games to pay off debts after her mother's death. Young-Il, a heartless soul, controls the games, watching everything from afar while sipping on his glass of whisky. But this year is different. When he spots Y/N, number 160, during the game of "Red Light, Green Light," he can't help but grow more obsessed with her. The first game ends, and Young-Il decides it's time to join the games himself, meet her, and make her his forever. Not that he will allow anyone else to even look at her But will Y/N really trust him?
This is Me Trying ⭑ Rafe Cameron by -inslaytiable
60 parts Ongoing
After a year away at Kitty Hawk, Cassie Maybank returns to the Outerbanks with a determination to get her life back on track. To stay healthy, to make her own friends, to live a normal, steady life like every teenage girl should. But after hearing the news of the passing of one of her closest friends, and coming back to the island, she realizes her brother's letters severely underestimated how much had truly changed. A lot can happen in a year. Friends become strangers, brothers become liars. Some enemies become allies, some enemies become lovers. © Inslaytiable | June 22nd, 2023
The Brink of Minds | Tim Bradford by writer_daydreamerr
34 parts Ongoing
❝I've been falling every day since I first met you.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s? ─ slow-burn, flirting, some spice ─ updating every other day!! ⊱ ──────── ➤ ──────── ⊰
𝑴𝒊𝒏-𝒆 || Min Ho x Reader by liv__ing
42 parts Complete
(season 2 out now!) 𝒊𝒏 𝒘𝒉𝒊𝒄𝒉 two famous teens fake date... until it becomes real. (xo, kitty) __ (Y/N) Novoselsky, born to two world-renowned movie stars, is attending KISS this year. Her mother is forcing her to live in Korea: and woo the son of one of her co-stars. His name? Min Ho. The problem is, he seems rude to her, and she clearly can't stand him. But the turns are tableing when he's the one chasing after her, and he's the one who has to prove himself. ❝ you make me do stupid things ❞ ❝ are you sure you aren't doing that on your own? ❞ ⋆ ｡𖦹° ⭒˚｡⋆ #1 in xokitty #1 in minho #1 in sangheonlee #1 in minhoxokitty #1 in minhoxreader #1 in to all the boys #6 in fanfiction
[Blue Archive] And Where All Hatred Begins by ihatenumber
200 parts Ongoing
One day, a curse befell Sensei. To the students, Sensei became the enemy, and he found himself in a position where he lost everything overnight. But Sensei does not resent the students. Because he is 'Sensei'. And Sensei has to face the calamity that would befall Kivotos once again. [블루 아카이브] 그리고 모든 증오가 시작되는 곳 Author: 비솔티 279+ Chapters (Ongoing) 1,210,000+ Total Words
Naruto: Copy System by Dragon155913
157 parts Ongoing
Reborn in the Naruto world, Shin Uzumaki finds himself in the doomed Land of Whirlpools. As a member of the Uzumaki Clan! Trapped in a world filled with war, betrayal, and unimaginable power, Shin's survival seems impossible.. Until it isn't!! [Ding! Replication System Activated!] [Daily Login Reward: Common Replication Card.] [Newbie Gift: Perfect Sage Body-Adamantine Sealing Chains-Four Symbols Seal] With the power to Copy any Ability-whether it's the Kekkei Genkai or Rinnegan or Forbidden jutsu-Shin begins his journey to dominate the Ninja World. [First task: Save Kushina and prevent the destruction of the Uzumaki Clan.]
Masked Obsession by ILoveDrarryAndAnime
41 parts Ongoing
"You're different from what I expected," she said softly. "How so?" he asked, glancing at her. "I don't know," she replied, searching for the right words. "You just... have this way of making people feel like they matter. Even here, in this... nightmare." He was quiet for a moment before responding. "You matter, Y/n. Don't forget that." OR Y/n wakes up in the deadly Squid Game, surrounded by strangers and fighting to survive. What she doesn't know is that the mysterious Frontman is watching her every move through the cameras- and she's caught his attention.
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) by megavrses
45 parts Ongoing
❝ he might think i'm weird, but i can't help it, i've fallen for him. ❞ 𝐢𝐧 𝐰𝐡𝐢𝐜𝐡 two enemies finally see the good side to each other started: 11.26.24 ended: achievements #4 in korean (OUT OF 1000+ STORIES) {1.19.25} #2 in jennyhan {1.19.25} #2 in toalltheboys {1.19.25} #5 in toalltheboysivelovedbefore {1.19.25} #1 in psistillloveyou {1.19.25} #1 in sangheonlee {1.19.25} #2 in kittycovey {1.19.25} #1 in alwaysandforeverlarajean {1.19.25} #3 in minhoxokitty {1.19.25} #1 in choiminyoung {1.19.25} #2 in anthony keyvan {1.19.25}
You may also like
Slide 1 of 10
Rafe Cameron Imagines (for horny bitches) cover
𝙘𝙡𝙤𝙨𝙚 𝙩𝙤 𝙮𝙤𝙪 • 𝙧𝙖𝙛𝙚 𝙘𝙖𝙢𝙚𝙧𝙤𝙣 cover
Behind the Mask (001xY/N fanfiction) cover
This is Me Trying ⭑ Rafe Cameron cover
The Brink of Minds | Tim Bradford cover
𝑴𝒊𝒏-𝒆 || Min Ho x Reader cover
[Blue Archive] And Where All Hatred Begins cover
Naruto: Copy System cover
Masked Obsession cover
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) cover

Rafe Cameron Imagines (for horny bitches)

28 parts Ongoing

SEXy Rafe Cameron Imagines for b*tches who need a good, god damn fantasy

More details