𝐒𝐭𝐨𝐫𝐦 𝐂𝐥𝐨𝐮𝐝𝐬 🖊
SweetNovellas
  • Reads 10
  • Votes 1
  • Parts 1
  • Time <5 mins
  • Reads 10
  • Votes 1
  • Parts 1
  • Time <5 mins
SweetNovellas
Ongoing, First published Feb 25, 2022
bloodlustborncontrolcovenfantasygirlmagicnewnewgirlparanormalpowersromanceschoolsupernaturalthirstvampirewitch
"Why did you save me?"

"We didn't need a crazed, newborn vampire on the lose." 

"And here I thought it was because of our love." 

彡彡彡

Saber had it all, until one day she was changed into a vampire. Forced into an unexpected life, surrounded by those she once thought were freaks, Saber must find a way to survive. But that's difficult when more kids begin to disappear; her new family believes she's the killer; and a new girl threatening to chase her away.

The life of a vampire isn't an easy one.
All Rights Reserved
bloodlustborncontrolcovenfantasygirlmagicnewnewgirlparanormalpowersromanceschoolsupernaturalthirstvampirewitch
Table of contents

1 part

Sign up to add 𝐒𝐭𝐨𝐫𝐦 𝐂𝐥𝐨𝐮𝐝𝐬 🖊 to your library and receive updates
or
#194bloodlust
Content Guidelines
You may also like
Love and Other Wicked Things by writing00introvert
31 parts Complete
One story, multiple ways to enjoy it! Read the bestselling published book right here as Wattpad Original or experience the story as a Webcomic on WEBTOON. Dive into the world of love and magic, any way you like to read. *** Sometimes love is the strongest magic of all *** Nineteen-year-old Rhia Greenbrook has lived in the sleepy town of Oakriver in a house with three generations of witches her entire life. Rhia draws her magic from the earth and likes to spend her time amongst plants and nature. Her practice is gentle, sacred, and-per her family's tradition-secret. New-to-town witch Valerie Morgan is looking for answers about her mother's disappearance from Oakriver seventeen years ago. Without her mother's guidance, Valerie has cultivated her fire magic on her own and she makes no effort to keep her powers hidden. Although Rhia is immediately annoyed by Valerie's blatant use of magic, she can't deny the instant magnetism between them. But amidst their magical connection, a dark presence looms over Oakriver. Unsettling visions from Rhia's grandmother and dangerous sleepwalking episodes throw into question Valerie's past and what role her presence plays in the strange happenings. And as Valerie gets tangled up further into the darkness, it's up to Rhia to tap into the full potential of her power in order to save the town she loves and the girl she's fallen for.
Red String by chromatix
22 parts Complete
A novice cupid needs to help a girl and a ghost fulfil their romantic destiny after he mistakenly ties one end of the red string to the wrong boy. ***** What happens when your soulmate dies before you've even met him? The bookish Gemma Yang gets her shot at finding true love when novice faerie Jun is assigned to her case by the God of Marriage. All Jun has to do is one simple thing - tie the invisible red string of fate to the wrist of Gemma and her designated soulmate, the popular Hayden Chung, and let destiny work its magic. However, in a case of mistaken identity, he bungles things up by tying the string to the geeky Takahashi Ryu instead. To make matters worse, Ryu ends up being knocked down by a reckless driver outside the university campus minutes later - and dies. With this massive hot potato in his hands, Jun embarks on a mission to cover up for his mistake and return things to the way they should be - but things rarely go as planned, or do they? Content warning: This story contains mild violence (fight scenes) Cover designed by Ilafi Nastiti
Playing With Matches by Sam_le_fou
38 parts Complete
Chuck Colt, a cowardly and highly neurotic ghost, must find a way to reunite his soul to his newly zombified body before dawn, lest his (un)death becomes permanent. ***** When Chuck Colt, a neurotic Movie Critic, inexplicably sees his own corpse hanging from a ceiling fan, he comes to the sudden realization that he is somehow a ghost. To make matters worse, his body seems to be moving on its own, and it doesn't like to follow Chuck's instructions. Now, both Ghost and Zombie Chuck must work together in order to find a cure for their undead curse before sundown, lest they get stuck like that for eternity - if one of the city's weird assortment of characters doesn't get to them first. The pair must comb through the magical city of New Orleans, facing multiple obstacles along the way - including but not limited to: werepugs, suicidal vampires, and trigger-happy priests - but the biggest obstacle they face is time. Can Chuck Colt beat the clock to be whole again, or will the Big Easy prove to be too hard to handle? For what is Tragedy, but Comedy - Time? TW: Mentions of self-harm, suicide. Cover by @IAmRodneyVSmith
Yours, Raven by HermyneKhaling
59 parts Complete
Limited Time: 40% off February Sale Alert! Save big, now until February 25th! *** Now available as Audiobook on Audible India. When thirteen year old Raven wrote a love letter to Nicholas who was twenty, he never imagined that one day this little girl would grow up and steal his heart completely. *** Raven was only thirteen and silly when she wrote her first love letter and faced her first heartbreak. Nicholas, a 20-year-old young man who, besides being her brother's best friend, besides being off-limits by traditional norms considered her a little sister, and he told her that she'd find the right guy when she's older. Nicholas eventually joined the army and Raven grew up. Years later, during a summer holiday, when Nicholas sees her again as a 19-year-old college girl - all grown up - he fell for her. Hard. And he'd have to fight against the feeling for it was against their traditional norms. [Book two - Signed, Gaius] [Wattpad Editor's Choice] Content warning: This story contains mature sexual content Cover designed by Regina Dionela
Lethe's Kiss (Ari & Soren Book 3) by OwlieCat
57 parts Complete
When Soren's father disappears, Ari and Soren are left to unravel the mysteries of Volkir's past as an old enemy threatens the present. ***** Two years have gone by since Soren turned, and now his father wants him to take his place as Master of his realm. Soren has no desire to inherit his father's responsibilities, however, and would rather live a simple, uncomplicated life with his witch-mage husband and life-mate, Ari Lorenfield. Ari has enough on his plate as it is, having taken over leadership of the Guardian Circle, and Soren worries he'll work himself to death if he doesn't learn to say 'no.' When a mysterious new-blooded vampire appears bearing a strange message, though, Volkir vanishes, leaving Soren in charge of his domain. As new perils surface, Ari and Soren must look to their friends for help as they seek to discover the secrets of Volkir's past and save their own future. - ⚠️ Book 3 of the Ari & Soren series 1️⃣: Bound by Blood 2️⃣: Hecate's Gift - Rating/Warnings: PG-13, light romance, language, violence. Cover designed by Adam Budny
Bite Me by stayonbrand
36 parts Complete
Werewolves and vampires don't mix, or that's what Kieran Callisto, a seventeen-year-old vampire, has believed all his life - until he falls for the Alpha's son. ***** When Kieran meets his new classmate, Mason Kane, he bristles with an unexplainable disdain. Soon it becomes apparent why: Mason is a werewolf. But when a fight turns into a sudden kiss that neither expects, Kieran's feelings for Mason turn to attraction in an instant. None of it makes sense - vampires and werewolves are supposed to be mortal enemies, so why does Kieran find Mason so irresistible? He knows that each kiss is dangerous, each bite is unpredictable...
Bound by Blood by OwlieCat
31 parts Complete
When Ari touches a cursed artifact and becomes possessed by a powerful spell, he must find a way to control it or risk losing himself and the half-vampire he loves. ***** Aristotle Lorenfield knows he's unusual. He lives in a museum of haunted objects, studies ancient magics, and is unapologetically asexual. He's used to being alone and doesn't want anything more. Then, one day, his archeologist uncle sends him a mysterious artifact in the mail, thrusting Ari into a world of real magic, necromantic cults, supernatural beings, and dangerous secrets. Torn from the comfort of his solitude, Ari must face the pain in his past, and the truth in himself, if he hopes to survive and save the man he's come to love - but the greatest dangers lie closer to home than he thinks. Cover designed by Adam Budny
Rooming with the Wicked by allrenwrote
48 parts Ongoing
After barely surviving an attempt on her life, alchemy student Ariel investigates her new supernatural roommates as possible suspects. Nothing can prepare her for the secrets she is about to uncover about her own family-or her infuriating demon roommate's constant attempts to get under her skin. Season 1 of The Wicked Series *** Ariel is no stranger to bad luck. Life has been an uphill battle with an estranged father and a stepbrother who hates her. Studying alchemy feels like a dream come true, at least until Ariel suspects one of her new supernatural roommates might be trying to kill her. Refusing to be an easy target, she uses her alchemy skills to protect herself and dives headfirst into her own investigation. When unsettling truths about Ariel's family and the world she lives in come to light, she realizes that those she suspects most might be her best allies. None of her newfound friends are quite what they seem-especially Haze. A demon of sloth should not be this hard to avoid, yet Haze defies all expectations, making it increasingly difficult for Ariel to deny the growing attraction between them. Still, the closer Ariel gets to finding out the truth, the more she fears her trust may have been misplaced. *** Weekly updates on Mondays. Wait & read for free, or unlock with coins-the choice is yours!
Darkly Deceived (Darkly Devoted Series, Book 2) by KateLorraine
35 parts Complete
Vivienne has spent the last three years living with the knowledge that she killed Blake. But as soon as she decides to let him go, she notices strange occurrences that show he might still be around... ***** After years of mourning the death of her true love, Vivienne is finally trying to move on - until mysterious phone calls and anonymous gifts start to arrive. After an ill-fated one-night-stand with her sister's former flame, Julian, Vivienne's suspicions start to grow. Despite Julian's insistence that nothing strange is going on, Vivienne begins to wonder if she is mad or if Blake could be alive. [[word count: 80,000-90,000 words]] Cover designed by Anastasia Wright
The Last Heiress by KateLorraine
33 parts Complete
Once a wealthy heiress, Angela is left penniless after the mob attacks her family. After fleeing to Manna City, she has no choice but to rely on the good graces of a man whose marriage proposal she once rejected. As Angela explores her newfound freedom and revels in the company of a beautiful, like-minded seamstress, she must find her place in the world and discover the secrets within her own heart.
You may also like
Slide 1 of 10
Love and Other Wicked Things cover
Red String cover
Playing With Matches cover
Yours, Raven cover
Lethe's Kiss (Ari & Soren Book 3) cover
Bite Me cover
Bound by Blood cover
Rooming with the Wicked cover
Darkly Deceived (Darkly Devoted Series, Book 2) cover
The Last Heiress cover

Love and Other Wicked Things

31 parts Complete

One story, multiple ways to enjoy it! Read the bestselling published book right here as Wattpad Original or experience the story as a Webcomic on WEBTOON. Dive into the world of love and magic, any way you like to read. *** Sometimes love is the strongest magic of all *** Nineteen-year-old Rhia Greenbrook has lived in the sleepy town of Oakriver in a house with three generations of witches her entire life. Rhia draws her magic from the earth and likes to spend her time amongst plants and nature. Her practice is gentle, sacred, and-per her family's tradition-secret. New-to-town witch Valerie Morgan is looking for answers about her mother's disappearance from Oakriver seventeen years ago. Without her mother's guidance, Valerie has cultivated her fire magic on her own and she makes no effort to keep her powers hidden. Although Rhia is immediately annoyed by Valerie's blatant use of magic, she can't deny the instant magnetism between them. But amidst their magical connection, a dark presence looms over Oakriver. Unsettling visions from Rhia's grandmother and dangerous sleepwalking episodes throw into question Valerie's past and what role her presence plays in the strange happenings. And as Valerie gets tangled up further into the darkness, it's up to Rhia to tap into the full potential of her power in order to save the town she loves and the girl she's fallen for.

More details