Master's bride I & II
qudseesheikh
  • Reads 1,935
  • Votes 140
  • Parts 51
  • Time 4h 28m
  • Reads 1,935
  • Votes 140
  • Parts 51
  • Time 4h 28m
qudseesheikh
Complete, First published Feb 27, 2022
Mature
18andup18plusforcedmarriagehyderabadindiaindiawestbrooksindiawriterkidskisslosslovehatelovetrianglemafiapastwantwattpadmafiawattpadromancewriterwriting
Nothing can be more surprising than getting married to someone you hate, and the person you love is doing nothing to stop that from happening. 

Yes, that's exactly what happened with Greta, she was forced to marry Liam who she hated to the core while her love, he stood there watching and congratulating her on the wedding.
All Rights Reserved
18andup18plusforcedmarriagehyderabadindiaindiawestbrooksindiawriterkidskisslosslovehatelovetrianglemafiapastwantwattpadmafiawattpadromancewriterwriting
Table of contents

51 parts

Sign up to add Master's bride I & II to your library and receive updates
or
Content Guidelines
You may also like
π€π πšπ’π§π¬π­ π„πšπœπ‘ 𝐎𝐭𝐑𝐞𝐫 by Cazzotutto
55 parts Complete
"You are Marrying ME!" I ordered her. "WHATTT!!!!" her eyes almost came out of sockets and she looked at me with a shocked face while I was looking at her with same cold face. "Wth! I knew that you were an arrogant brat but you can't force me to marry you!" "Shut up ok!! You are Marrying me and that's FINAL don't you dare deny this proposal!" I told her in a cold and most dangerous Voice. "Yo.. you can't fo..force me" she said stammering a bit due to pain she was feeling when I pressed her wrist. "Of course I can look I don't want to marry anyone but now it has came to my mom's life so you are Marrying me you will just have to pretend to be my wife" "And why do you think I'll do that!" She shout at me..how dare she! "You will marry me if you want your family ALIVE!" I threatened her dangerously. "You...you wi..will not ha..harm my..fa..family right?" She asked with most shocked and scared face. "Try me" I smirked, And her breath got hitched. 1st in #siddharthnigam on 17/8/23 1st in #India on19/2/24 2nd in #hatelove on 19/2/24
The Love That Hurts (#Billionaire's Obsession) | βœ“ by _purplesky12
60 parts Complete Mature
π‘»π’‰π’Šπ’” π’˜π’‚π’” 𝒕𝒉𝒆 π’—π’†π’“π’š π’‡π’Šπ’“π’”π’• π’‘π’‚π’ˆπ’† 𝑡𝒐𝒕 π’˜π’‰π’†π’“π’† 𝒕𝒉𝒆 π’”π’•π’π’“π’š π’π’Šπ’π’† 𝒆𝒏𝒅𝒔; It started with his love. Will it end with her misery or her love? Not every arrange marriage starts with hate but still it involves P.A.I.N "Don't lie, Amisha. I'm sick of these lies. And if you're so sure that you didn't cheat on me, then fine, let's move on to the next step,prove me you didn't cheated on me" he said, and she frowned in confusion. He realized she didn't understand his intention. "Get intimate with me, tell me that you love me, and I'll believe you. I'll believe that you're telling the truth," he said, or more precisely, made an offer. She couldn't process his words. Her heart broke as she listened to him. Would he only trust her if she offered her body? Was this the basis of their relationship? Did he only want her physically, nothing else? β€’β€’β€’β€’β€’ "Make it a habit, this is our end"- she said in a low voice with her sobs interuppting her words. "No, you and I have no end, darling. We are forever together," he said with a soft smile. "Be in delusion, to spend a minute with you is so difficult; let's forget about forever" she said in a harsh tone and left from there. (The book contains forced proximity, NO RA-E)
𝐍𝐞𝐯𝐞𝐫 𝐌𝐒𝐧𝐞 by ufarawrites
16 parts Ongoing Mature
#Book 1 from Never Duet "You would never be more than just a replacement, you'd never be mine." Despite having no choice in the matter, she reluctantly agreed to be his replacement bride. No fight or struggle could diminish his anger and hatred towards her and her family. He was determined to marry her, no matter what it took, and vowed to bring her pain and suffering. She was not to hold any hope in her heart of this turning into a fairytale romance. He would make sure of that. There would be no love or kindness from him, only cold, dark determination to hurt her as much as possible. Tropes: Replaced bride Marriage of convenience Forced marriage Age gap Artist x Businessman Forced proximity
My One Night Marriage βœ…οΈ by Mahi12rg
27 parts Complete Mature
"Marriage can be frightening, especially when we are young. But what happens when a girl is forced to get married against her will due to family pressure? Will she find happiness and love with her new, unknown husband, or will she be trapped in a new kind of hell? Please be advised that the following story is intended for mature audiences. If any scene or character in this story causes any discomfort, it is unintentional and not meant to cause harm. "This story is my original work, so I kindly request you not to copy it. The pictures used in this story are sourced from social media sites and do not belong to me. I am aware that my writing skills may not be perfect, and English is not my first language. Therefore, if you come across any errors or mistakes, please feel free to point them out as I am still learning."
Aradhya:- His Beautiful Disaster.. by SSneha7
41 parts Complete Mature
His Peaceful life turned chaotic the day she stepped into his life. She is hiding so many secrets which can be dangerous for his clan and He will never let anyone destroy the empire his forefather made with great passion. There are so many enemies who are eyeing Suryavanshi's and she could be one of them. He never breaks his promise. His words helds its own beauty. He Knows that she will his toughest competition. Meanwhile, will he be able to ignore the unknown pull towards her which forces him to re-think about her that there is something else which is hidden from him. Alas! Where will a relationship full of hatred and secrets take him? _______ Her life has always been adventurous. Its her life and her rules. She is a rebel. A beauty with so many secrets. A simple girl with not so simple life. The day she stepped into his life, she knew that he will create hurdles in her life but She ain't less than him. If she loves someone the most in the world, then it is her mother. Her promises are always half, Every color of her intentions helds its own grace. Will she able to give him competition. Leaving all this apart, will she be able to ignore the pull towards him. Will she be able to change his mind for her. Alas! Where will a relationship full of hatred and secrets take her. ________ In the middle of everything, How will their love story emerge. If he has anger issues then she is no less. If he spits fire then she is cold as ice. The heat of his body melts the frozen paths of her heart. He sets rules and she breaks them. The story based on revenge, filled with conspiracy and misunderstanding. _________ Start- June 7, 2023 End- July 14, 2023 A Fictional story. This work is mine so please do not copy or report it. Its my hardwork. Everything is fictional except the places. Do not hate comment in the story. If you don't like it, then leave it. As simple as it sounds. Alas! Let's meet in the story. _________
Love at First Kiss: My [Un]Fake Husband by Uniquelyme2010
7 parts Complete
It's a world where hierarchy is very important. Society is ruled by the ones with more power. Power of money, Power of strength. and Peat had none. Because he is born as the weakest of both. But he is not ready to accept his fate predetermined at the time of his birth. He wants to change it. He wants to climb the social ladder. He wants to be respected for his skill, his ability and his intelligence. He is smarter than most people he has ever met in his life. But never respected enough because of his birth. But he thinks he deserves more than what he is getting. So he decides to find someone who can help him climb the ladder without asking for anything in return. It's hard but not impossible. He has seen it happening around him. Or he can choose to lie _____________________ Timeline Disclaimer: Future where LGBTQ marriage is legal. Another contract marriage tropes!! Inspired from : My perfect husband
Forced √ by happyfeet20
26 parts Complete
IF YOU HAVE DECIDED TO GIVE MY STORY A CHANCE BECAUSE YOU LIKE THE BOOK COVER, THEN YOU ARE ABOUT TO BE DISAPPOINTED BECAUSE THE STORY IS NOT EVEN HALF AS GOOD AS THE COVER. BOOK COVER CREDITS : @ixiolite β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’ " That is not possible, Sir. She is already engaged to another man." " I don't care, call off the engagement. I want your daughter to marry my son." "ButδΈ€" " or else, you and your brother....... I hope you know what I am trying to tell you" β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’ Love marriage? No. Arranged marriage? Psht, no! It was a forced marriage. β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’β€’ READERS PLEASE NOTE THAT THIS STORY MAY CONTAIN CURSES AND PROFANITIES. IF ONE IS NOT COMFORTABLE WITH THEM PLEASE DO NOT READ IT. ALTHOUGH THERE IS NO SEXUAL CONTENT IN THE BOOK THE LANGUAGE MAY BE A LITTLE MATURE. THANK YOU.
Ranvi: his undeniable amour| 18+ (Duet #02) by talethatneverends
78 parts Complete Mature
A sequence of Ranvi: his flow of life. [DARK ROMANCE] I love him, he loves me too, more than his life. But- What if my husband is ready to snatch my life? Love. I thought he loved me but turns out everything was a game to trap me. I was foolish to fall in love with a devil who was always ready to kill me. He protected me from the demons from my childhood only to haunt me every passing second. Aaran Russo did everything possible to force me into a marriage I once died for. The game of lies didn't start here, it started with my foolishness when I forced our destiny to tangle into each other. I hacked his laptop and gave the sign of my fate to him. That was my mistake and now-I am going to pay for it with my soul. Because my husband will never let me go away from him. I am too well tangled with him that now the more I run, the more I will end up in his tricks. His lies. His threats. And maybe his soul. (18+) (CAN'T BE READ AS A STANDALONE)
Bairi Sanam: The hate of a lover by writersabode24
53 parts Complete Mature
When two equally powerful souls come together, their strength enhances, and it makes them capable of moving mountains and uprooting trees together. But what if this union begins with hatred? When passion and yearning combines, then the underlying feelings of love come out in a different way. Ketaki Vyaas, an idol of courage and kindness. She would tend to the wound she has given you herself. Tejasvin Dhyutidhara, an epitome of valour and knowledge. Even if his ways are immoral at times, he'd bring justice to your feet regardless. His love is fire and she's afraid to burn. What happens when they unite in the village of Raghavaiah into a forced marriage? What happens when the person you hate becomes your biggest support?
Promised Love by simpforwords
52 parts Complete Mature
Saanvi Rajput and Abhimanyu Malhotra have been sworn enemies since they first met at ten years old, so the last thing they ever expected to be were husband and wife to eachother. But all thanks to a promise made between their grandfathers years ago, they are both forced into a relationship neither of them wants. For Abhimanyu this marriage is an obstacle in his way to marry the girl he actually loves and for Saanvi it's a sick joke the universe is playing on her. Can a happily ever after be possible for two people who refuse to give eachother a chance? [TW: Cheating] PS: READ AT YOUR OWN RISK. I WROTE THIS BOOK WHEN I WAS SIXTEEN #1 in wattpadindia (7/2/22) #1 in loveaftermarriage (26/1/22) #2 in hatelove (22/1/22) #2 in india (13/2/22) #1 in indianromance (7/5/22) #1 in Jaipur (21/10/22) #2 in crush (13/4/23)
You may also like
Slide 1 of 10
π€π πšπ’π§π¬π­ π„πšπœπ‘ 𝐎𝐭𝐑𝐞𝐫 cover
The Love That Hurts (#Billionaire's Obsession) | βœ“ cover
𝐍𝐞𝐯𝐞𝐫 𝐌𝐒𝐧𝐞 cover
My One Night Marriage βœ…οΈ cover
Aradhya:- His Beautiful Disaster.. cover
Love at First Kiss: My [Un]Fake Husband cover
Forced √ cover
Ranvi: his undeniable amour| 18+ (Duet #02) cover
Bairi Sanam: The hate of a lover cover
Promised Love cover

π€π πšπ’π§π¬π­ π„πšπœπ‘ 𝐎𝐭𝐑𝐞𝐫

55 parts Complete

"You are Marrying ME!" I ordered her. "WHATTT!!!!" her eyes almost came out of sockets and she looked at me with a shocked face while I was looking at her with same cold face. "Wth! I knew that you were an arrogant brat but you can't force me to marry you!" "Shut up ok!! You are Marrying me and that's FINAL don't you dare deny this proposal!" I told her in a cold and most dangerous Voice. "Yo.. you can't fo..force me" she said stammering a bit due to pain she was feeling when I pressed her wrist. "Of course I can look I don't want to marry anyone but now it has came to my mom's life so you are Marrying me you will just have to pretend to be my wife" "And why do you think I'll do that!" She shout at me..how dare she! "You will marry me if you want your family ALIVE!" I threatened her dangerously. "You...you wi..will not ha..harm my..fa..family right?" She asked with most shocked and scared face. "Try me" I smirked, And her breath got hitched. 1st in #siddharthnigam on 17/8/23 1st in #India on19/2/24 2nd in #hatelove on 19/2/24

More details