life is so unpredictable (JIKOOK)
Jimeo1234
  • Reads 28
  • Votes 3
  • Parts 1
  • Time <5 mins
  • Reads 28
  • Votes 3
  • Parts 1
  • Time <5 mins
Jimeo1234
Ongoing, First published Mar 17, 2022
Mature
actionbtsgayhobijhopejikookjinjminjungkookkookminlawyermafiamarriedmysterynaminnamjoonromancesopesugataehyungyoongi
PARK JIMIN the criminal lawyer just came back from London to Korea after completing his graduation .
Strict to his words and laws and can do anything to provide justice to the persons who had suffered because of some fuckers.


On the other hand , there is JEON JUNGKOOK  who don't care about rules and regulations . Train  criminals in his shelter ,Known for vicious plan executions around the whole country.


What's gonna happen when these two  comes face to face?

Well this story is about the sequence of incidents how things turned upside down....when they stood against eachother.


Read first chapter for short summary.

                -----------------------------------


Author's note:-

What to expect :- A lot of love fluff ,action , romance,  mystery, court trials , friendship goals , fancy parties , mellodrama, revenge and a ofcourse smut 😏.


Side ships:-
 
1) Taehyung × maria
2) Jhope × suga
3) Jin   × namjoon
4) kathreena × ?
5) porshiya × ?

 ⚠️ Warnings:-

All rights reserved.... don't even try to plagiarise my book.

🔞 Only adults are prescribed to read this book

                          ----------------------


Book cover credit goes to:- Mariyasayyada
All Rights Reserved
actionbtsgayhobijhopejikookjinjminjungkookkookminlawyermafiamarriedmysterynaminnamjoonromancesopesugataehyungyoongi
Table of contents

1 part

Sign up to add life is so unpredictable (JIKOOK) to your library and receive updates
or
Content Guidelines
You may also like
𝙘𝙡𝙤𝙨𝙚 𝙩𝙤 𝙮𝙤𝙪 • 𝙧𝙖𝙛𝙚 𝙘𝙖𝙢𝙚𝙧𝙤𝙣 by delicatessss
56 parts Ongoing
A Maybank and A Cameron? It's almost like a modern Romeo and Juliet. It's forbidden for them to be together. Could be the end of the world. The stolen glances, the hidden feelings, the unspoken words, the secret meetings and the obvious hatred towards each other followed by constant conflicts and some hidden past that threatened them but there are always invisible strings tied and pulling them together no matter how hard the tides trying to pull and part them away from each other.
𝐂𝐎𝐍𝐅𝐋𝐈𝐂𝐓𝐄𝐃─𝐨𝐮𝐭𝐞𝐫 𝐛𝐚𝐧𝐤𝐬 by paradiseearth
125 parts Ongoing
in which charlotte carrera finds herself more conflicted than she has ever been in her entire life. rafe cameron x fem! oc || seasons one + two + three of outer banks! started: 08.14.21 finished: tbd
Protection | Hwang In-Ho x Reader by lucywhitee
23 parts Ongoing
With the pains getting worse, the debt looming over her and the consequences sinking in, Y/N sees no other option than to blindly join the game.They seemed fine at first. Until the first gunshot rung out. With players continually voting to stay, Y/N seeks safety with a previous winner and his group. Including player 001. -- TW - Swearing Death Gore Illness Sensitive topics Smut (OPTIONAL to read it)
ᴇʟʏꜱɪᴀɴ | BNHA by sxftreo
78 parts Ongoing
Various BNHA X Fem Reader. Where an inauspicious girl meets her doom and ultimately gets transported into the chaos of My Hero Academia.
Behind the Mask (001xY/N fanfiction) by deliaaanamaria
23 parts Ongoing
Y/N, a simple woman, joins the deadly games to pay off debts after her mother's death. Young-Il, a heartless soul, controls the games, watching everything from afar while sipping on his glass of whisky. But this year is different. When he spots Y/N, number 160, during the game of "Red Light, Green Light," he can't help but grow more obsessed with her. The first game ends, and Young-Il decides it's time to join the games himself, meet her, and make her his forever. Not that he will allow anyone else to even look at her But will Y/N really trust him?
𝐓𝐇𝐀𝐓'𝐒 𝐒𝐎 𝐓𝐑𝐔𝐄 • SQUID GAME 2 by s4naminatozaki
26 parts Ongoing
𝐓𝐇𝐀𝐓'𝐒 𝐒𝐎 𝐓𝐑𝐔𝐄 ──── ❝ Made it out alive, but I think I lost it ❞ A disgraced K-pop idol, drowning in billions of won in debt, enters the infamous Squid Game to escape her financial ruin. Forced to compete in twisted games inspired by her past as an idol-singing, dancing, and deadly performances-she must navigate betrayal, trauma, and the haunting ties of the sinister organizers. In a world where every move is life or death, her only hope is to reclaim her voice and outsmart the system. SQUID GAME SEASON 2 X fem! oc [ 𝐓𝐇𝐀𝐓'𝐒 𝐒𝐎 𝐓𝐑𝐔𝐄 ] ©s4naminatozaki
[Blue Archive] And Where All Hatred Begins by ihatenumber
171 parts Ongoing
One day, a curse befell Sensei. To the students, Sensei became the enemy, and he found himself in a position where he lost everything overnight. But Sensei does not resent the students. Because he is 'Sensei'. And Sensei has to face the calamity that would befall Kivotos once again. [블루 아카이브] 그리고 모든 증오가 시작되는 곳 Author: 비솔티 265+ Chapters (Ongoing) 1,110,000+ Total Words
Slytherin Boys Imagines by povsbyliz
140 parts Ongoing
Imagines and Oneshots from the Harry Potter Universe ✧₊⁺ Draco Malfoy, Mattheo Riddle, Theodore Nott, Lorenzo Berkshire, Pansy Parkinson, Tom Riddle. The story features AI generated images (created by me). Take a real look into the world of Hogwarts while falling in love with the Slytherin Boys! 𝘈𝘭𝘭 𝘤𝘩𝘢𝘳𝘢𝘤𝘵𝘦𝘳𝘴 𝘣𝘦𝘭𝘰𝘯𝘨 𝘵𝘰 𝘵𝘩𝘦𝘪𝘳 𝘳𝘦𝘴𝘱𝘦𝘤𝘵𝘪𝘷𝘦 𝘰𝘸𝘯𝘦𝘳𝘴, 𝘢𝘯𝘥 𝘤𝘰𝘱𝘺𝘳𝘪𝘨𝘩𝘵 𝘰𝘧 𝘵𝘩𝘦 𝘴𝘰𝘶𝘳𝘤𝘦 𝘮𝘢𝘵𝘦𝘳𝘪𝘢𝘭 𝘣𝘦𝘭𝘰𝘯𝘨𝘴 𝘵𝘰 𝘑.𝘒. 𝘙𝘰𝘸𝘭𝘪𝘯𝘨. 𝘊𝘰𝘷𝘦𝘳 𝘢𝘳𝘵 𝘧𝘳𝘰𝘮 𝘗𝘪𝘹𝘢𝘣𝘢𝘺 𝘶𝘴𝘦𝘳 Gaetanob1992.
Naruto: Copy System by Dragon155913
124 parts Ongoing
Reborn in the Naruto world, Shin Uzumaki finds himself in the doomed Land of Whirlpools. As a member of the Uzumaki Clan! Trapped in a world filled with war, betrayal, and unimaginable power, Shin's survival seems impossible.. Until it isn't!! [Ding! Replication System Activated!] [Daily Login Reward: Common Replication Card.] [Newbie Gift: Perfect Sage Body-Adamantine Sealing Chains-Four Symbols Seal] With the power to Copy any Ability-whether it's the Kekkei Genkai or Rinnegan or Forbidden jutsu-Shin begins his journey to dominate the Ninja World. [First task: Save Kushina and prevent the destruction of the Uzumaki Clan.]
You may also like
Slide 1 of 9
𝙘𝙡𝙤𝙨𝙚 𝙩𝙤 𝙮𝙤𝙪 • 𝙧𝙖𝙛𝙚 𝙘𝙖𝙢𝙚𝙧𝙤𝙣 cover
𝐂𝐎𝐍𝐅𝐋𝐈𝐂𝐓𝐄𝐃─𝐨𝐮𝐭𝐞𝐫 𝐛𝐚𝐧𝐤𝐬 cover
Protection | Hwang In-Ho x Reader cover
ᴇʟʏꜱɪᴀɴ | BNHA cover
Behind the Mask (001xY/N fanfiction) cover
𝐓𝐇𝐀𝐓'𝐒 𝐒𝐎 𝐓𝐑𝐔𝐄 • SQUID GAME 2 cover
[Blue Archive] And Where All Hatred Begins cover
Slytherin Boys Imagines cover
Naruto: Copy System cover

𝙘𝙡𝙤𝙨𝙚 𝙩𝙤 𝙮𝙤𝙪 • 𝙧𝙖𝙛𝙚 𝙘𝙖𝙢𝙚𝙧𝙤𝙣

56 parts Ongoing

A Maybank and A Cameron? It's almost like a modern Romeo and Juliet. It's forbidden for them to be together. Could be the end of the world. The stolen glances, the hidden feelings, the unspoken words, the secret meetings and the obvious hatred towards each other followed by constant conflicts and some hidden past that threatened them but there are always invisible strings tied and pulling them together no matter how hard the tides trying to pull and part them away from each other.

More details