life is so unpredictable (JIKOOK)
Jimeo1234
  • Reads 28
  • Votes 3
  • Parts 1
  • Time <5 mins
  • Reads 28
  • Votes 3
  • Parts 1
  • Time <5 mins
Jimeo1234
Ongoing, First published Mar 17, 2022
Mature
actionbtsgayhobijhopejikookjinjminjungkookkookminlawyermafiamarriedmysterynaminnamjoonromancesopesugataehyungyoongi
PARK JIMIN the criminal lawyer just came back from London to Korea after completing his graduation .
Strict to his words and laws and can do anything to provide justice to the persons who had suffered because of some fuckers.


On the other hand , there is JEON JUNGKOOK  who don't care about rules and regulations . Train  criminals in his shelter ,Known for vicious plan executions around the whole country.


What's gonna happen when these two  comes face to face?

Well this story is about the sequence of incidents how things turned upside down....when they stood against eachother.


Read first chapter for short summary.

                -----------------------------------


Author's note:-

What to expect :- A lot of love fluff ,action , romance,  mystery, court trials , friendship goals , fancy parties , mellodrama, revenge and a ofcourse smut 😏.


Side ships:-
 
1) Taehyung × maria
2) Jhope × suga
3) Jin   × namjoon
4) kathreena × ?
5) porshiya × ?

 ⚠️ Warnings:-

All rights reserved.... don't even try to plagiarise my book.

🔞 Only adults are prescribed to read this book

                          ----------------------


Book cover credit goes to:- Mariyasayyada
All Rights Reserved
actionbtsgayhobijhopejikookjinjminjungkookkookminlawyermafiamarriedmysterynaminnamjoonromancesopesugataehyungyoongi
Table of contents

1 part

Sign up to add life is so unpredictable (JIKOOK) to your library and receive updates
or
Content Guidelines
You may also like
Bad Idea Right ✸ Kwon Jae-Sung by twsired
27 parts Complete
❝ seeing you tonight it's a bad idea, right? ❞ COBRA KAI s6 pt 2 - 3 kwon x fem oc highest rankings: #5 miguel diaz #3 kwonjaesung
In DxD with Sign-In System! by Dragon155913
67 parts Ongoing
Transmigrated into DxD World-Kuoh Town, Hibari Kyoya. an average student, spent 18 agonizing years in the world fully aware of the dangers, knowing he is utterly powerless in a world of gods and monsters, Until... [Ding! Sign-In System loading... 20%... 50%... 80%... 100%.] Destiny, it seems.. has a cruel sense of humor. A [Sign-In System], long overdue, finally bursts to life within him, offering a chance at survival, a chance at power... [Ding! Congratulations! You have received the Rainbow-Grade Gift Bag!] ... He then started completing System's tasks, accumulating even greater rewards. [Ding! Task completed. Reward: Perfect Rumble-Rumble Fruit (Weakness to water Removed).] [Ding! Task completed. Congratulations to the host for obtaining the Flying Thunder God Technique!]
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) by megavrses
54 parts Ongoing
❝ he might think i'm weird, but i can't help it, i've fallen for him. ❞ 𝐢𝐧 𝐰𝐡𝐢𝐜𝐡 two enemies finally see the good side to each other started: 11.26.24 ended: achievements #4 in korean (OUT OF 1000+ STORIES) {1.19.25} #2 in jennyhan {1.19.25} #2 in toalltheboys {1.19.25} #5 in toalltheboysivelovedbefore {1.19.25} #1 in psistillloveyou {1.19.25} #1 in sangheonlee {1.19.25} #2 in kittycovey {1.19.25} #1 in alwaysandforeverlarajean {1.19.25} #3 in minhoxokitty {1.19.25} #1 in choiminyoung {1.19.25} #2 in anthony keyvan {1.19.25}
Lady of the Dark Mark | T.M.R by hxwarts24
68 parts Ongoing
❝ ah, but it was not tom riddle who made the dark mark. ❞ dumbledore's eyes fogged over, a memory of the once-smart and cunning student entering his mind as he stroked his white beard. ❝ then who did, sir? ❞ harry potter stared at the headmaster, dumbfounded. ❝ tom riddle's one and only love: ravena. athena ravena malfoy. lady of the dark mark. ❞ ────୨ৎ──── ↳ in which the first generation of the death eaters rise to power, and the malfoy twins choose the dark. one chooses to lead alongside the dark lord, while the other chooses to be a follower. ── .✦ tom riddle x oc ── .✦ dark academia, academic rivals to lovers, found family, slowburn. ── .✦ tom riddle era + first wizarding war era + marauder's era + golden trio era | second wizarding war era - regular updates every friday -
Naruto: Copy System by Dragon155913
181 parts Ongoing
Reborn in the Naruto world, Shin Uzumaki finds himself in the doomed Land of Whirlpools. As a member of the Uzumaki Clan! Trapped in a world filled with war, betrayal, and unimaginable power, Shin's survival seems impossible.. Until it isn't!! [Ding! Replication System Activated!] [Daily Login Reward: Common Replication Card.] [Newbie Gift: Perfect Sage Body-Adamantine Sealing Chains-Four Symbols Seal] With the power to Copy any Ability-whether it's the Kekkei Genkai or Rinnegan or Forbidden jutsu-Shin begins his journey to dominate the Ninja World. [First task: Save Kushina and prevent the destruction of the Uzumaki Clan.]
This is Me Trying ⭑ Rafe Cameron by -inslaytiable
62 parts Ongoing
After a year away at Kitty Hawk, Cassie Maybank returns to the Outerbanks with a determination to get her life back on track. To stay healthy, to make her own friends, to live a normal, steady life like every teenage girl should. But after hearing the news of the passing of one of her closest friends, and coming back to the island, she realizes her brother's letters severely underestimated how much had truly changed. A lot can happen in a year. Friends become strangers, brothers become liars. Some enemies become allies, some enemies become lovers. © Inslaytiable | June 22nd, 2023
BURNING PILE » MIGUEL DIAZ by crownsmist
85 parts Ongoing
❝ALL MY TROUBLES ON A BURNING PILE ALL LIT UP AND I START TO SMILE.❞ MIGUEL DIAZ X FEM!OC SEASON 1 - 6 crownsmist, 2022 cover by @norasnetflix
Slytherin Boys Imagines by povsbyliz
144 parts Ongoing
Imagines and Oneshots from the Harry Potter Universe ✧₊⁺ Draco Malfoy, Mattheo Riddle, Theodore Nott, Lorenzo Berkshire, Pansy Parkinson, Tom Riddle. The story features AI generated images (created by me). Take a real look into the world of Hogwarts while falling in love with the Slytherin Boys! 𝘈𝘭𝘭 𝘤𝘩𝘢𝘳𝘢𝘤𝘵𝘦𝘳𝘴 𝘣𝘦𝘭𝘰𝘯𝘨 𝘵𝘰 𝘵𝘩𝘦𝘪𝘳 𝘳𝘦𝘴𝘱𝘦𝘤𝘵𝘪𝘷𝘦 𝘰𝘸𝘯𝘦𝘳𝘴, 𝘢𝘯𝘥 𝘤𝘰𝘱𝘺𝘳𝘪𝘨𝘩𝘵 𝘰𝘧 𝘵𝘩𝘦 𝘴𝘰𝘶𝘳𝘤𝘦 𝘮𝘢𝘵𝘦𝘳𝘪𝘢𝘭 𝘣𝘦𝘭𝘰𝘯𝘨𝘴 𝘵𝘰 𝘑.𝘒. 𝘙𝘰𝘸𝘭𝘪𝘯𝘨. 𝘊𝘰𝘷𝘦𝘳 𝘢𝘳𝘵 𝘧𝘳𝘰𝘮 𝘗𝘪𝘹𝘢𝘣𝘢𝘺 𝘶𝘴𝘦𝘳 Gaetanob1992.
The Brink of Minds | Tim Bradford by writer_daydreamerr
42 parts Ongoing
❝I've been falling every day since I first met you.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s? ─ slow-burn, flirting, some spice ─ updating every other day!! ⊱ ──────── ➤ ──────── ⊰
Behind the Mask (001xY/N fanfiction) by deliaaaana
36 parts Ongoing
Y/N, a simple woman, joins the deadly games to pay off debts after her mother's death. Young-Il, a heartless soul, controls the games, watching everything from afar while sipping on his glass of whisky. But this year is different. When he spots Y/N, number 160, during the game of "Red Light, Green Light," he can't help but grow more obsessed with her. The first game ends, and Young-Il decides it's time to join the games himself, meet her, and make her his forever. Not that he will allow anyone else to even look at her But will Y/N really trust him?
You may also like
Slide 1 of 10
Bad Idea Right ✸ Kwon Jae-Sung cover
In DxD with Sign-In System! cover
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) cover
Lady of the Dark Mark | T.M.R cover
Naruto: Copy System cover
This is Me Trying ⭑ Rafe Cameron cover
BURNING PILE » MIGUEL DIAZ cover
Slytherin Boys Imagines cover
The Brink of Minds | Tim Bradford cover
Behind the Mask (001xY/N fanfiction) cover

Bad Idea Right ✸ Kwon Jae-Sung

27 parts Complete

❝ seeing you tonight it's a bad idea, right? ❞ COBRA KAI s6 pt 2 - 3 kwon x fem oc highest rankings: #5 miguel diaz #3 kwonjaesung

More details